Sorex fumeus (smoky shrew): 130028539 Help Entry 130028539         CDS       T10594                                  Symbol CSTB Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism sfum  Sorex fumeus (smoky shrew) Brite KEGG Orthology (KO) [BR:sfum00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:sfum01002]     130028539 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfum04147]     130028539 (CSTB) Peptidases and inhibitors [BR:sfum01002]  Peptidase inhibitors   Family I25: cystatin family    130028539 (CSTB) Exosome [BR:sfum04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    130028539 (CSTB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin SQAPI Motif Other DBs NCBI-GeneID:  130028539 NCBI-ProteinID:  XP_055975215 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MMCGAPTATQPATPDTQAIADQVRAQLEEKENRKFNTFKAVEYKSQVVAGRNYFIKVQVD EDEFAHLRVFESLPHENKPLVLANYQTSKARHDELTYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggggcccccaccgccacgcagcccgccacccccgacacccaggccatcgcc gatcaggtcagggcccagctggaggagaaggagaaccggaaattcaacacctttaaggcc gtggagtacaagtcccaagtggtggctggaaggaattacttcatcaaggttcaggtggat gaggacgagttcgcacatctccgcgtgttcgagagcctcccacacgagaacaagcccttg gtcctggccaactaccagacgagcaaagcccggcacgatgagctgacctacttctag

DBGET integrated database retrieval system