Sorex fumeus (smoky shrew): 130029163 Help Entry 130029163         CDS       T10594                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04014   Ras signaling pathway sfum04137   Mitophagy - animal sfum04144   Endocytosis sfum04145   Phagosome sfum04148   Efferocytosis sfum04962   Vasopressin-regulated water reabsorption sfum05132   Salmonella infection sfum05146   Amoebiasis sfum05152   Tuberculosis Brite KEGG Orthology (KO) [BR:sfum00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     130029163 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     130029163 (RAB5B)    04145 Phagosome     130029163 (RAB5B)    04137 Mitophagy - animal     130029163 (RAB5B)    04148 Efferocytosis     130029163 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     130029163 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130029163 (RAB5B)    05152 Tuberculosis     130029163 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     130029163 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sfum04131]     130029163 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfum04147]     130029163 (RAB5B)    04031 GTP-binding proteins [BR:sfum04031]     130029163 (RAB5B) Membrane trafficking [BR:sfum04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     130029163 (RAB5B)  Endosome - Lysosome transport     130029163 (RAB5B) Exosome [BR:sfum04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130029163 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    130029163 (RAB5B)   Exosomal proteins of colorectal cancer cells    130029163 (RAB5B)   Exosomal proteins of melanoma cells    130029163 (RAB5B) GTP-binding proteins [BR:sfum04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     130029163 (RAB5B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  130029163 NCBI-ProteinID:  XP_055976021 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagcaaggcccaacgggcagccccaggccagcaaaatatgtcag ttcaaattggtcctgcttggtgaatctgcggtggggaagtctagcctggtattacgtttt gtcaaagggcagttccatgagtaccaggagagtactattggagcggccttcctcacccag tctgtctgcctagatgacacaacagtcaagtttgagatctgggacacagctgggcaggag cgataccatagcttggcccctatgtactacagaggtgcccaagctgcaattgtggtttat gatattactaatcaggaaacctttgcccgggcaaagacatgggtaaaggagctacagcga caggccagccctagcatcgttattgccctggcggggaacaaagctgatctagccaacaag cgcatggtggagtacgaagaggcccaggcgtacgcagatgacaacagcttattgtttatg gagacttcagctaagacagctatgaacgtgaacgacctcttcctggcaatagctaagaag ttgccaaagagcgaaccccagaacctggggggtgcagcaggccgaagccggggtgtggat ctccacgagcagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system