Sorex fumeus (smoky shrew): 130030057 Help Entry 130030057         CDS       T10594                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04080   Neuroactive ligand-receptor interaction sfum04081   Hormone signaling sfum04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:sfum00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     130030057 (GHRH)    04081 Hormone signaling     130030057 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     130030057 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sfum04052]     130030057 (GHRH) Cytokines and neuropeptides [BR:sfum04052]  Neuropeptides   GPCR binding    130030057 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  130030057 NCBI-ProteinID:  XP_055977168 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MQLWVFFLVTLALGSESCCPPPSPPLRTPRYADAIFSNGYRKVLGQLSARKLLQDILSRR QGERSQEPGAKARLGRAVDHMWATQEQVVPDSILRALLRERRNSQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgcagctctgggtcttcttcctggtcaccctcgccctgggcagcgagtcctgctgcccc ccaccctccccgcccctcaggacgccacgctacgcagatgccatcttcagcaacggctac cgcaaggtgctgggccagctgtcggcccgcaagctcctgcaggacatcctgagcaggcgg cagggagagcggagccaggagccaggcgccaaggcccggcttggccgtgcggtggaccac atgtgggcgacccaagagcaggtggtgccggacagcatcctgcgggccctgctgcgggag cgcaggaactcccagggatga

DBGET integrated database retrieval system