Sorex fumeus (smoky shrew): 130030515 Help Entry 130030515         CDS       T10594                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04015   Rap1 signaling pathway sfum04810   Regulation of actin cytoskeleton sfum05014   Amyotrophic lateral sclerosis sfum05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sfum00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     130030515 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     130030515 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130030515 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     130030515 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sfum04131]     130030515 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:sfum04812]     130030515 (PFN2)    04147 Exosome [BR:sfum04147]     130030515 (PFN2) Membrane trafficking [BR:sfum04131]  Others   Actin-binding proteins    Others     130030515 (PFN2) Cytoskeleton proteins [BR:sfum04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      130030515 (PFN2) Exosome [BR:sfum04147]  Exosomal proteins   Proteins found in most exosomes    130030515 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  130030515 NCBI-ProteinID:  XP_055977806 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggcagagctacgtggacaacctgatgtgcgacggctgctgccaggaggcc gccatcgtcggctactgcgacgccaaatacgtgtgggccgccacggccgggggcgtcttc cagagcatcacgccggtagaaatagacatgatcgtaggaaaagaccgggaaggtttcttt accaatggtttgactcttggcgccaagaagtgctcggtgatcagagacagcctgtacgtg gacggagactgcacaatggacatccggacaaagagtcaaggtggggagcccacgtacaac gtggccgtcggcagagctggcagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system