Sorex fumeus (smoky shrew): 130031088 Help Entry 130031088         CDS       T10594                                  Symbol JUN Name (RefSeq) transcription factor Jun   KO K04448   transcription factor AP-1 Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum01522   Endocrine resistance sfum04010   MAPK signaling pathway sfum04012   ErbB signaling pathway sfum04024   cAMP signaling pathway sfum04137   Mitophagy - animal sfum04210   Apoptosis sfum04310   Wnt signaling pathway sfum04380   Osteoclast differentiation sfum04510   Focal adhesion sfum04530   Tight junction sfum04620   Toll-like receptor signaling pathway sfum04621   NOD-like receptor signaling pathway sfum04625   C-type lectin receptor signaling pathway sfum04657   IL-17 signaling pathway sfum04658   Th1 and Th2 cell differentiation sfum04659   Th17 cell differentiation sfum04660   T cell receptor signaling pathway sfum04662   B cell receptor signaling pathway sfum04668   TNF signaling pathway sfum04722   Neurotrophin signaling pathway sfum04912   GnRH signaling pathway sfum04915   Estrogen signaling pathway sfum04921   Oxytocin signaling pathway sfum04926   Relaxin signaling pathway sfum04932   Non-alcoholic fatty liver disease sfum04933   AGE-RAGE signaling pathway in diabetic complications sfum05030   Cocaine addiction sfum05031   Amphetamine addiction sfum05132   Salmonella infection sfum05133   Pertussis sfum05135   Yersinia infection sfum05140   Leishmaniasis sfum05142   Chagas disease sfum05161   Hepatitis B sfum05162   Measles sfum05166   Human T-cell leukemia virus 1 infection sfum05167   Kaposi sarcoma-associated herpesvirus infection sfum05169   Epstein-Barr virus infection sfum05170   Human immunodeficiency virus 1 infection sfum05171   Coronavirus disease - COVID-19 sfum05200   Pathways in cancer sfum05203   Viral carcinogenesis sfum05207   Chemical carcinogenesis - receptor activation sfum05208   Chemical carcinogenesis - reactive oxygen species sfum05210   Colorectal cancer sfum05211   Renal cell carcinoma sfum05224   Breast cancer sfum05231   Choline metabolism in cancer sfum05235   PD-L1 expression and PD-1 checkpoint pathway in cancer sfum05321   Inflammatory bowel disease sfum05323   Rheumatoid arthritis sfum05417   Lipid and atherosclerosis sfum05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:sfum00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130031088 (JUN)    04012 ErbB signaling pathway     130031088 (JUN)    04310 Wnt signaling pathway     130031088 (JUN)    04668 TNF signaling pathway     130031088 (JUN)    04024 cAMP signaling pathway     130031088 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     130031088 (JUN)   09143 Cell growth and death    04210 Apoptosis     130031088 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     130031088 (JUN)    04530 Tight junction     130031088 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     130031088 (JUN)    04621 NOD-like receptor signaling pathway     130031088 (JUN)    04625 C-type lectin receptor signaling pathway     130031088 (JUN)    04660 T cell receptor signaling pathway     130031088 (JUN)    04658 Th1 and Th2 cell differentiation     130031088 (JUN)    04659 Th17 cell differentiation     130031088 (JUN)    04657 IL-17 signaling pathway     130031088 (JUN)    04662 B cell receptor signaling pathway     130031088 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     130031088 (JUN)    04915 Estrogen signaling pathway     130031088 (JUN)    04921 Oxytocin signaling pathway     130031088 (JUN)    04926 Relaxin signaling pathway     130031088 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     130031088 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     130031088 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     130031088 (JUN)    05207 Chemical carcinogenesis - receptor activation     130031088 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     130031088 (JUN)    05203 Viral carcinogenesis     130031088 (JUN)    05231 Choline metabolism in cancer     130031088 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     130031088 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     130031088 (JUN)    05211 Renal cell carcinoma     130031088 (JUN)    05224 Breast cancer     130031088 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     130031088 (JUN)    05170 Human immunodeficiency virus 1 infection     130031088 (JUN)    05161 Hepatitis B     130031088 (JUN)    05171 Coronavirus disease - COVID-19     130031088 (JUN)    05162 Measles     130031088 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     130031088 (JUN)    05169 Epstein-Barr virus infection     130031088 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     130031088 (JUN)    05135 Yersinia infection     130031088 (JUN)    05133 Pertussis     130031088 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     130031088 (JUN)    05142 Chagas disease     130031088 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     130031088 (JUN)    05321 Inflammatory bowel disease     130031088 (JUN)   09165 Substance dependence    05030 Cocaine addiction     130031088 (JUN)    05031 Amphetamine addiction     130031088 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     130031088 (JUN)    05418 Fluid shear stress and atherosclerosis     130031088 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     130031088 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     130031088 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     130031088 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:sfum03000]     130031088 (JUN) Transcription factors [BR:sfum03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     130031088 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf Rab11-FIP3 RIMB1_N ZapB PspA_IM30 Fib_alpha DUF3450 FlaC_arch Motif Other DBs NCBI-GeneID:  130031088 NCBI-ProteinID:  XP_055978313 LinkDB All DBs Position Unknown AA seq 346 aa AA seqDB search MTAKMETTFYDDALNASFLPSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGLVAPAVASVAGGGGGGGGGGGFGAGLHSEPPVYANLSNF NPGALGGGGGGSGGGGGAPSYGAPGLAFPAQPQPPPPPPPQPPHHLSQQLPVQHPRLQAL KEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVK TLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt atgaccgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctgccg tccgagagcggcgcctacggctacagtaaccccaagatcctgaagcagagcatgaccctg aacctggccgacccggtgggcagcctcaagccgcacctccgcgccaagaactcggacctg ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctcgagcgcctgatc atccagtccagcaacgggcacatcaccaccacgccgacccccacgcagttcctgtgcccc aagaacgtgacggacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgag ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggcgcg ggcctggtggcgcccgccgtggcctcggtggcgggcggcggcggcggcggcggcggcggc ggcggcttcggcgcgggcctgcacagcgagccgccggtctacgccaacctcagcaacttc aacccgggcgcgctgggcggcggcggcgggggcagcggcggcggcggcggggcgccctcg tacggcgcgcccgggctggcctttcccgcgcagccccagccgccgccgccgccgccgccg cagccgccgcaccacctgtcccagcagctccccgtgcagcacccgcggctgcaggccctg aaggaggagccgcagacggtgcccgagatgcccggcgagacgccgcccctgtccccgatc gacatggagtcccaggagcgcatcaaggcggagaggaagcgcatgaggaaccgcatcgcc gcctccaagtgccggaaaaggaagctggagcgcatcgcgcggctggaggaaaaagtgaaa accttgaaagcgcagaactcggagctggcgtccaccgccaacatgctccgcgagcaggtg gcccagctcaagcagaaagtcatgaaccacgttaacagcgggtgccagctcatgctcacg cagcagttgcagacgttctga

DBGET integrated database retrieval system