Sorex fumeus (smoky shrew): 130035747 Help Entry 130035747         CDS       T10594                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04060   Cytokine-cytokine receptor interaction sfum04061   Viral protein interaction with cytokine and cytokine receptor sfum04062   Chemokine signaling pathway sfum04620   Toll-like receptor signaling pathway sfum04621   NOD-like receptor signaling pathway sfum04623   Cytosolic DNA-sensing pathway sfum04668   TNF signaling pathway sfum05020   Prion disease sfum05142   Chagas disease sfum05163   Human cytomegalovirus infection sfum05164   Influenza A sfum05168   Herpes simplex virus 1 infection sfum05323   Rheumatoid arthritis sfum05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:sfum00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     130035747 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     130035747 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     130035747 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     130035747 (CCL5)    04621 NOD-like receptor signaling pathway     130035747 (CCL5)    04623 Cytosolic DNA-sensing pathway     130035747 (CCL5)    04062 Chemokine signaling pathway     130035747 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     130035747 (CCL5)    05168 Herpes simplex virus 1 infection     130035747 (CCL5)    05163 Human cytomegalovirus infection     130035747 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     130035747 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     130035747 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     130035747 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     130035747 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sfum04052]     130035747 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:sfum00536]     130035747 (CCL5) Cytokines and neuropeptides [BR:sfum04052]  Cytokines   Chemokines    130035747 (CCL5) Glycosaminoglycan binding proteins [BR:sfum00536]  Heparan sulfate / Heparin   Chemokines    130035747 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 REC102 Motif Other DBs NCBI-GeneID:  130035747 NCBI-ProteinID:  XP_055983606 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MQGSTAALALVLATAALCAPASASPHASDTTPCCFSYIGRSVPRAHIQEYFYTSSKCSMP AVVFITRKKRQVCANPEDRWVRKYINSMEMN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgcaggggtccaccgctgccctcgccctcgtgctggccaccgcagccctgtgcgcacct gcgtccgcctccccacatgcctcggacaccacgccctgctgcttctcctacatcggccgc tccgtgccacgggcccacatccaggaatatttctacaccagcagcaagtgctccatgccg gcagtcgtttttatcacacgaaagaaacgccaggtgtgtgccaacccagaggacagatgg gtgcggaagtacatcaactctatggagatgaactag

DBGET integrated database retrieval system