Sorex fumeus (smoky shrew): 130036853 Help Entry 130036853         CDS       T10594                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04015   Rap1 signaling pathway sfum04810   Regulation of actin cytoskeleton sfum05014   Amyotrophic lateral sclerosis sfum05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sfum00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     130036853 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     130036853 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130036853 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     130036853 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sfum04131]     130036853 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:sfum04812]     130036853 (PFN4)    04147 Exosome [BR:sfum04147]     130036853 (PFN4) Membrane trafficking [BR:sfum04131]  Others   Actin-binding proteins    Others     130036853 (PFN4) Cytoskeleton proteins [BR:sfum04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      130036853 (PFN4) Exosome [BR:sfum04147]  Exosomal proteins   Proteins found in most exosomes    130036853 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  130036853 NCBI-ProteinID:  XP_055984745 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSHLQNLLLDSLLGTRHVDSAALIRLQDQSLCVSSPGFNLMPCDILKLVNDFARNPLGTR REGLYFKEKDYTCVRADDYSLYAKNVNSGVIVVKTHLYLVVSTYTKGMYPSVCVEATEKL GDYLRRKRS NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaatttgctgttagattccctcctaggaacgaggcatgtggacagt gcagctctcatcaggctccaggaccaatccttatgtgtctcatcaccggggtttaatctg atgccctgtgatatcctaaagctggtgaatgacttcgccaggaaccctttgggaacccga agagaaggattgtatttcaaagaaaaggattatacatgtgtccgggcagatgattattct ctttatgctaagaatgtgaattctggtgtgattgttgtgaagactcatctgtatcttgtg gtgtcaacttacaccaaaggcatgtaccccagtgtctgtgtggaagccacagagaaactg ggtgactatctaagaagaaaaagaagttaa

DBGET integrated database retrieval system