Sorex fumeus (smoky shrew): 130037492 Help Entry 130037492         CDS       T10594                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04137   Mitophagy - animal sfum04140   Autophagy - animal sfum04144   Endocytosis sfum04145   Phagosome sfum04148   Efferocytosis sfum05132   Salmonella infection sfum05146   Amoebiasis sfum05152   Tuberculosis Brite KEGG Orthology (KO) [BR:sfum00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     130037492 (RAB7A)    04145 Phagosome     130037492 (RAB7A)    04140 Autophagy - animal     130037492 (RAB7A)    04137 Mitophagy - animal     130037492 (RAB7A)    04148 Efferocytosis     130037492 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130037492 (RAB7A)    05152 Tuberculosis     130037492 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     130037492 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sfum04131]     130037492 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfum04147]     130037492 (RAB7A)    04031 GTP-binding proteins [BR:sfum04031]     130037492 (RAB7A) Membrane trafficking [BR:sfum04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     130037492 (RAB7A) Exosome [BR:sfum04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130037492 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    130037492 (RAB7A)   Exosomal proteins of colorectal cancer cells    130037492 (RAB7A)   Exosomal proteins of bladder cancer cells    130037492 (RAB7A) GTP-binding proteins [BR:sfum04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     130037492 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  130037492 NCBI-ProteinID:  XP_055985310 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggtcatcatcttgggagattctggggtcggt aagacatccctcatgaaccagtatgtgaacaagaaattcagcaatcagtacaaagccaca ataggagcagacttcctgacaaaggaggtgatggtggatgacagactagtcacgatgcag atctgggacacggccggacaggagcggttccagtccctcggcgtggccttctacagaggc gcagactgctgcgtgctggtgttcgacgtgaccgcccccaacaccttcaagaccctggac agctggagagacgagtttctcatccaggccagtccccgggatcccgagaacttccccttt gtcgtgttgggaaacaagatcgacctcgaaaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatc aacgtggagcaggccttccagaccatcgcgcggaacgctctcaagcaggagacagaggtg gagctctacaatgaattccccgagcccatcaaactggacaagaacgaccgggctaaagcc tcggcagagagctgcagctgctga

DBGET integrated database retrieval system