Sorex fumeus (smoky shrew): 130037585 Help Entry 130037585         CDS       T10594                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04014   Ras signaling pathway sfum04137   Mitophagy - animal sfum04144   Endocytosis sfum04145   Phagocytosis sfum04148   Efferocytosis sfum04962   Vasopressin-regulated water reabsorption sfum05014   Amyotrophic lateral sclerosis sfum05022   Pathways of neurodegeneration - multiple diseases sfum05132   Salmonella infection sfum05146   Amoebiasis sfum05152   Tuberculosis Brite KEGG Orthology (KO) [BR:sfum00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     130037585 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     130037585 (RAB5A)    04145 Phagocytosis     130037585 (RAB5A)    04137 Mitophagy - animal     130037585 (RAB5A)    04148 Efferocytosis     130037585 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     130037585 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130037585 (RAB5A)    05152 Tuberculosis     130037585 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     130037585 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     130037585 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     130037585 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sfum04131]     130037585 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfum04147]     130037585 (RAB5A)    04031 GTP-binding proteins [BR:sfum04031]     130037585 (RAB5A) Membrane trafficking [BR:sfum04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     130037585 (RAB5A)  Endosome - Lysosome transport     130037585 (RAB5A) Exosome [BR:sfum04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130037585 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    130037585 (RAB5A)   Exosomal proteins of colorectal cancer cells    130037585 (RAB5A)   Exosomal proteins of bladder cancer cells    130037585 (RAB5A) GTP-binding proteins [BR:sfum04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     130037585 (RAB5A) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 BrnT_toxin Motif Other DBs NCBI-GeneID:  130037585 NCBI-ProteinID:  XP_055985447 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaatgggccaaatactggaaataaaatatgccag ttcaaactagtacttcttggagaatctgctgttggcaaatcaagcctagtgcttcgtttt gtgaaaggccagtttcatgaatttcaagagagtaccattggggctgcttttcttacccaa actgtgtgtctcgatgacacaacagtaaagtttgaaatatgggatacagcaggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagcagccattgttgtatat gatattacaaatgaggagtcctttgccagagccaaaaactgggttaaagaacttcagagg caagccagtcctaacatcgtaatagctttatcaggaaacaaggccgaccttgcaaataaa agagctgttgatttccaggaagcacagtcctatgcagatgacaacagcttattattcatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaatgaaccacagaatccaggagcaaactctgccagaggaagaggagtagac cttaccgaacccacacagccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system