Sorex fumeus (smoky shrew): 130038388 Help Entry 130038388         CDS       T10594                                  Name (RefSeq) late histone H2B.L4-like   KO K11252   histone H2B Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04613   Neutrophil extracellular trap formation sfum05034   Alcoholism sfum05203   Viral carcinogenesis sfum05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:sfum00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     130038388  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     130038388   09163 Immune disease    05322 Systemic lupus erythematosus     130038388   09165 Substance dependence    05034 Alcoholism     130038388  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sfum03036]     130038388   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfum04147]     130038388 Chromosome and associated proteins [BR:sfum03036]  Eukaryotic type   Nucleosome assembly factors    Histones     130038388 Exosome [BR:sfum04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130038388 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TAF MRP-S27 Motif Other DBs NCBI-GeneID:  130038388 NCBI-ProteinID:  XP_055986241 LinkDB All DBs Position Unknown AA seq 146 aa AA seqDB search MDQLVPEIVSEEPTLKEEDPAEAEQEAAKPKTQKRCRRRRQPRYSPSGLSCRRTYESFAI YFPRVLKTVQEGMSLSKQALCVLDSFVEDIFERIVREAAKLTQASNRVTITCQELQAAVR MLLPRELARNAEKEGTKAVLRYTENR NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atggatcagctggttccagagatcgtgtcggaggagcccaccctcaaggaagaagaccct gcagaggctgagcaggaggctgcgaagcccaagacgcagaagcgctgccgccgcaggcgg cagccacgctatagcccaagtggtctgtcctgccgtcgcacctacgagagcttcgccatc tacttccccagggtcctgaagactgtccaggagggcatgagcctctcgaagcaggccttg tgcgtcctggactcgttcgtggaagacatcttcgagcgcatcgtccgggaggcggcgaag ctgacccaggccagcaaccgggtgaccattacgtgccaggagctccaggcggctgtgcgg atgctgctgccacgagagcttgccaggaacgctgagaaagaaggtaccaaggccgtcctc cgctacaccgaaaacagatga

DBGET integrated database retrieval system