Sorex fumeus (smoky shrew): 130039395 Help Entry 130039395         CDS       T10594                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04814   Motor proteins sfum05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sfum00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     130039395 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130039395 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:sfum03037]     130039395 (DYNLT3)    04812 Cytoskeleton proteins [BR:sfum04812]     130039395 (DYNLT3) Cilium and associated proteins [BR:sfum03037]  Motile cilia and associated proteins   Dynein arm    130039395 (DYNLT3) Cytoskeleton proteins [BR:sfum04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      130039395 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  130039395 NCBI-ProteinID:  XP_055987274 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MEDYHRPGEEVGFNAEEAHNIVRECIDGVLSGEDYNQNSINQWTAAIVEQSLTHLVKLGK PYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAVAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggattatcaccgtcccggcgaagaggttggcttcaatgctgaggaggctcacaat attgttagagagtgcatagacggcgtcttgtctggtgaggattataaccagaacagcatc aatcaatggactgcagcaattgtggaacaatccttaactcatttggtcaagttggggaaa ccttataaatacattgtcacctgtgcggtggtccagaagagtgcctatggctttcatact gccagttcatgcttttgggatactacatctgatggaacctgcactgtaagatgggagaat cgaaccatgaactgcatcgttaatgtctttgctgttgctattgttctgtaa

DBGET integrated database retrieval system