Sorex fumeus (smoky shrew): 130039909 Help Entry 130039909         CDS       T10594                                  Symbol HRAS Name (RefSeq) GTPase HRas isoform X1   KO K02833   GTPase HRas Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum01521   EGFR tyrosine kinase inhibitor resistance sfum01522   Endocrine resistance sfum04010   MAPK signaling pathway sfum04012   ErbB signaling pathway sfum04014   Ras signaling pathway sfum04015   Rap1 signaling pathway sfum04062   Chemokine signaling pathway sfum04068   FoxO signaling pathway sfum04071   Sphingolipid signaling pathway sfum04072   Phospholipase D signaling pathway sfum04137   Mitophagy - animal sfum04140   Autophagy - animal sfum04144   Endocytosis sfum04150   mTOR signaling pathway sfum04151   PI3K-Akt signaling pathway sfum04210   Apoptosis sfum04211   Longevity regulating pathway sfum04213   Longevity regulating pathway - multiple species sfum04218   Cellular senescence sfum04360   Axon guidance sfum04370   VEGF signaling pathway sfum04371   Apelin signaling pathway sfum04510   Focal adhesion sfum04540   Gap junction sfum04550   Signaling pathways regulating pluripotency of stem cells sfum04625   C-type lectin receptor signaling pathway sfum04630   JAK-STAT signaling pathway sfum04650   Natural killer cell mediated cytotoxicity sfum04660   T cell receptor signaling pathway sfum04662   B cell receptor signaling pathway sfum04664   Fc epsilon RI signaling pathway sfum04714   Thermogenesis sfum04720   Long-term potentiation sfum04722   Neurotrophin signaling pathway sfum04725   Cholinergic synapse sfum04726   Serotonergic synapse sfum04730   Long-term depression sfum04810   Regulation of actin cytoskeleton sfum04910   Insulin signaling pathway sfum04912   GnRH signaling pathway sfum04915   Estrogen signaling pathway sfum04916   Melanogenesis sfum04917   Prolactin signaling pathway sfum04919   Thyroid hormone signaling pathway sfum04921   Oxytocin signaling pathway sfum04926   Relaxin signaling pathway sfum04929   GnRH secretion sfum04933   AGE-RAGE signaling pathway in diabetic complications sfum04935   Growth hormone synthesis, secretion and action sfum05010   Alzheimer disease sfum05022   Pathways of neurodegeneration - multiple diseases sfum05034   Alcoholism sfum05132   Salmonella infection sfum05160   Hepatitis C sfum05161   Hepatitis B sfum05163   Human cytomegalovirus infection sfum05165   Human papillomavirus infection sfum05166   Human T-cell leukemia virus 1 infection sfum05167   Kaposi sarcoma-associated herpesvirus infection sfum05170   Human immunodeficiency virus 1 infection sfum05200   Pathways in cancer sfum05203   Viral carcinogenesis sfum05205   Proteoglycans in cancer sfum05206   MicroRNAs in cancer sfum05207   Chemical carcinogenesis - receptor activation sfum05208   Chemical carcinogenesis - reactive oxygen species sfum05210   Colorectal cancer sfum05211   Renal cell carcinoma sfum05213   Endometrial cancer sfum05214   Glioma sfum05215   Prostate cancer sfum05216   Thyroid cancer sfum05218   Melanoma sfum05219   Bladder cancer sfum05220   Chronic myeloid leukemia sfum05221   Acute myeloid leukemia sfum05223   Non-small cell lung cancer sfum05224   Breast cancer sfum05225   Hepatocellular carcinoma sfum05226   Gastric cancer sfum05230   Central carbon metabolism in cancer sfum05231   Choline metabolism in cancer sfum05235   PD-L1 expression and PD-1 checkpoint pathway in cancer sfum05417   Lipid and atherosclerosis Brite Membrane trafficking [BR:sfum04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     130039909 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     130039909 (HRAS) Exosome [BR:sfum04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    130039909 (HRAS)   Exosomal proteins of colorectal cancer cells    130039909 (HRAS) GTP-binding proteins [BR:sfum04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     130039909 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  130039909 NCBI-ProteinID:  XP_055987860 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDIHQYREQIKRVKDSDDVPTVLVGNKCDL AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRLHKARKLSPPDEGGPG CTSCRCLLS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagctggtggtggtgggcgccggcggcgtgggcaagagcgcgctgacc atccagctcatccagaaccacttcgtggacgagtacgaccccacgatcgaggactcgtac cggaagcaggtggtcatcgacggggagacgtgcctgctggacatcctggacacggcgggc caggaggagtacagcgccatgcgggaccagtacatgcgcaccggggagggcttcctctgc gtgttcgccatcaacaacgccaagtccttcgaggacattcaccagtaccgggagcagatc aaacgcgtgaaggactcggacgacgtgcccaccgtgctggtggggaacaagtgtgacctg gccgcgcgtaccgtggagtcgcggcaggcgcaggacctggcgcgcagctacggcatcccc tacatcgagacgtcggccaagacgcgccagggcgtggaggatgccttctacacactggtg cgagagatccgcctgcacaaggcccgcaagctgagcccgcccgacgagggcggcccgggc tgcaccagctgccgctgcctgctctcctag

DBGET integrated database retrieval system