KEGG   Sorex fumeus (smoky shrew): 130039909
Entry
130039909         CDS       T10594                                 
Symbol
HRAS
Name
(RefSeq) GTPase HRas isoform X1
  KO
K02833  GTPase HRas
Organism
sfum  Sorex fumeus (smoky shrew)
Pathway
sfum01521  EGFR tyrosine kinase inhibitor resistance
sfum01522  Endocrine resistance
sfum04010  MAPK signaling pathway
sfum04012  ErbB signaling pathway
sfum04014  Ras signaling pathway
sfum04015  Rap1 signaling pathway
sfum04062  Chemokine signaling pathway
sfum04068  FoxO signaling pathway
sfum04071  Sphingolipid signaling pathway
sfum04072  Phospholipase D signaling pathway
sfum04137  Mitophagy - animal
sfum04140  Autophagy - animal
sfum04144  Endocytosis
sfum04150  mTOR signaling pathway
sfum04151  PI3K-Akt signaling pathway
sfum04210  Apoptosis
sfum04211  Longevity regulating pathway
sfum04213  Longevity regulating pathway - multiple species
sfum04218  Cellular senescence
sfum04360  Axon guidance
sfum04370  VEGF signaling pathway
sfum04371  Apelin signaling pathway
sfum04510  Focal adhesion
sfum04540  Gap junction
sfum04550  Signaling pathways regulating pluripotency of stem cells
sfum04625  C-type lectin receptor signaling pathway
sfum04630  JAK-STAT signaling pathway
sfum04650  Natural killer cell mediated cytotoxicity
sfum04660  T cell receptor signaling pathway
sfum04662  B cell receptor signaling pathway
sfum04664  Fc epsilon RI signaling pathway
sfum04714  Thermogenesis
sfum04720  Long-term potentiation
sfum04722  Neurotrophin signaling pathway
sfum04725  Cholinergic synapse
sfum04726  Serotonergic synapse
sfum04730  Long-term depression
sfum04810  Regulation of actin cytoskeleton
sfum04910  Insulin signaling pathway
sfum04912  GnRH signaling pathway
sfum04915  Estrogen signaling pathway
sfum04916  Melanogenesis
sfum04917  Prolactin signaling pathway
sfum04919  Thyroid hormone signaling pathway
sfum04921  Oxytocin signaling pathway
sfum04926  Relaxin signaling pathway
sfum04929  GnRH secretion
sfum04933  AGE-RAGE signaling pathway in diabetic complications
sfum04935  Growth hormone synthesis, secretion and action
sfum05010  Alzheimer disease
sfum05022  Pathways of neurodegeneration - multiple diseases
sfum05034  Alcoholism
sfum05132  Salmonella infection
sfum05160  Hepatitis C
sfum05161  Hepatitis B
sfum05163  Human cytomegalovirus infection
sfum05165  Human papillomavirus infection
sfum05166  Human T-cell leukemia virus 1 infection
sfum05167  Kaposi sarcoma-associated herpesvirus infection
sfum05170  Human immunodeficiency virus 1 infection
sfum05200  Pathways in cancer
sfum05203  Viral carcinogenesis
sfum05205  Proteoglycans in cancer
sfum05206  MicroRNAs in cancer
sfum05207  Chemical carcinogenesis - receptor activation
sfum05208  Chemical carcinogenesis - reactive oxygen species
sfum05210  Colorectal cancer
sfum05211  Renal cell carcinoma
sfum05213  Endometrial cancer
sfum05214  Glioma
sfum05215  Prostate cancer
sfum05216  Thyroid cancer
sfum05218  Melanoma
sfum05219  Bladder cancer
sfum05220  Chronic myeloid leukemia
sfum05221  Acute myeloid leukemia
sfum05223  Non-small cell lung cancer
sfum05224  Breast cancer
sfum05225  Hepatocellular carcinoma
sfum05226  Gastric cancer
sfum05230  Central carbon metabolism in cancer
sfum05231  Choline metabolism in cancer
sfum05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sfum05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sfum00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    130039909 (HRAS)
   04012 ErbB signaling pathway
    130039909 (HRAS)
   04014 Ras signaling pathway
    130039909 (HRAS)
   04015 Rap1 signaling pathway
    130039909 (HRAS)
   04370 VEGF signaling pathway
    130039909 (HRAS)
   04371 Apelin signaling pathway
    130039909 (HRAS)
   04630 JAK-STAT signaling pathway
    130039909 (HRAS)
   04068 FoxO signaling pathway
    130039909 (HRAS)
   04072 Phospholipase D signaling pathway
    130039909 (HRAS)
   04071 Sphingolipid signaling pathway
    130039909 (HRAS)
   04151 PI3K-Akt signaling pathway
    130039909 (HRAS)
   04150 mTOR signaling pathway
    130039909 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    130039909 (HRAS)
   04140 Autophagy - animal
    130039909 (HRAS)
   04137 Mitophagy - animal
    130039909 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    130039909 (HRAS)
   04218 Cellular senescence
    130039909 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    130039909 (HRAS)
   04540 Gap junction
    130039909 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    130039909 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    130039909 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    130039909 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    130039909 (HRAS)
   04660 T cell receptor signaling pathway
    130039909 (HRAS)
   04662 B cell receptor signaling pathway
    130039909 (HRAS)
   04664 Fc epsilon RI signaling pathway
    130039909 (HRAS)
   04062 Chemokine signaling pathway
    130039909 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    130039909 (HRAS)
   04929 GnRH secretion
    130039909 (HRAS)
   04912 GnRH signaling pathway
    130039909 (HRAS)
   04915 Estrogen signaling pathway
    130039909 (HRAS)
   04917 Prolactin signaling pathway
    130039909 (HRAS)
   04921 Oxytocin signaling pathway
    130039909 (HRAS)
   04926 Relaxin signaling pathway
    130039909 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    130039909 (HRAS)
   04919 Thyroid hormone signaling pathway
    130039909 (HRAS)
   04916 Melanogenesis
    130039909 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    130039909 (HRAS)
   04726 Serotonergic synapse
    130039909 (HRAS)
   04720 Long-term potentiation
    130039909 (HRAS)
   04730 Long-term depression
    130039909 (HRAS)
   04722 Neurotrophin signaling pathway
    130039909 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    130039909 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    130039909 (HRAS)
   04213 Longevity regulating pathway - multiple species
    130039909 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    130039909 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    130039909 (HRAS)
   05206 MicroRNAs in cancer
    130039909 (HRAS)
   05205 Proteoglycans in cancer
    130039909 (HRAS)
   05207 Chemical carcinogenesis - receptor activation
    130039909 (HRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    130039909 (HRAS)
   05203 Viral carcinogenesis
    130039909 (HRAS)
   05230 Central carbon metabolism in cancer
    130039909 (HRAS)
   05231 Choline metabolism in cancer
    130039909 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    130039909 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    130039909 (HRAS)
   05225 Hepatocellular carcinoma
    130039909 (HRAS)
   05226 Gastric cancer
    130039909 (HRAS)
   05214 Glioma
    130039909 (HRAS)
   05216 Thyroid cancer
    130039909 (HRAS)
   05221 Acute myeloid leukemia
    130039909 (HRAS)
   05220 Chronic myeloid leukemia
    130039909 (HRAS)
   05218 Melanoma
    130039909 (HRAS)
   05211 Renal cell carcinoma
    130039909 (HRAS)
   05219 Bladder cancer
    130039909 (HRAS)
   05215 Prostate cancer
    130039909 (HRAS)
   05213 Endometrial cancer
    130039909 (HRAS)
   05224 Breast cancer
    130039909 (HRAS)
   05223 Non-small cell lung cancer
    130039909 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    130039909 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    130039909 (HRAS)
   05161 Hepatitis B
    130039909 (HRAS)
   05160 Hepatitis C
    130039909 (HRAS)
   05163 Human cytomegalovirus infection
    130039909 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    130039909 (HRAS)
   05165 Human papillomavirus infection
    130039909 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    130039909 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    130039909 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    130039909 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    130039909 (HRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    130039909 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    130039909 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    130039909 (HRAS)
   01522 Endocrine resistance
    130039909 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sfum04131]
    130039909 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfum04147]
    130039909 (HRAS)
   04031 GTP-binding proteins [BR:sfum04031]
    130039909 (HRAS)
Membrane trafficking [BR:sfum04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    130039909 (HRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    130039909 (HRAS)
Exosome [BR:sfum04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   130039909 (HRAS)
  Exosomal proteins of colorectal cancer cells
   130039909 (HRAS)
GTP-binding proteins [BR:sfum04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    130039909 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N
Other DBs
NCBI-GeneID: 130039909
NCBI-ProteinID: XP_055987860
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDIHQYREQIKRVKDSDDVPTVLVGNKCDL
AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRLHKARKLSPPDEGGPG
CTSCRCLLS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggagtacaagctggtggtggtgggcgccggcggcgtgggcaagagcgcgctgacc
atccagctcatccagaaccacttcgtggacgagtacgaccccacgatcgaggactcgtac
cggaagcaggtggtcatcgacggggagacgtgcctgctggacatcctggacacggcgggc
caggaggagtacagcgccatgcgggaccagtacatgcgcaccggggagggcttcctctgc
gtgttcgccatcaacaacgccaagtccttcgaggacattcaccagtaccgggagcagatc
aaacgcgtgaaggactcggacgacgtgcccaccgtgctggtggggaacaagtgtgacctg
gccgcgcgtaccgtggagtcgcggcaggcgcaggacctggcgcgcagctacggcatcccc
tacatcgagacgtcggccaagacgcgccagggcgtggaggatgccttctacacactggtg
cgagagatccgcctgcacaaggcccgcaagctgagcccgcccgacgagggcggcccgggc
tgcaccagctgccgctgcctgctctcctag

DBGET integrated database retrieval system