Sorex fumeus (smoky shrew): 130040023 Help Entry 130040023         CDS       T10594                                  Symbol CFL1 Name (RefSeq) cofilin-1 isoform X1   KO K05765   cofilin Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04360   Axon guidance sfum04666   Fc gamma R-mediated phagocytosis sfum04810   Regulation of actin cytoskeleton sfum05133   Pertussis sfum05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:sfum00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     130040023 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     130040023 (CFL1)   09158 Development and regeneration    04360 Axon guidance     130040023 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     130040023 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     130040023 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sfum04131]     130040023 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:sfum04812]     130040023 (CFL1)    04147 Exosome [BR:sfum04147]     130040023 (CFL1) Membrane trafficking [BR:sfum04131]  Others   Actin-binding proteins    Others     130040023 (CFL1) Cytoskeleton proteins [BR:sfum04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      130040023 (CFL1) Exosome [BR:sfum04147]  Exosomal proteins   Proteins found in most exosomes    130040023 (CFL1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  130040023 NCBI-ProteinID:  XP_055988022 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcttccggcgtggctgtgtccgatggtgtcatcaaggtgttcaatgacatgaaggtg cgcaagtcgtccacccccgaggaggtgaagaagcgcaagaaggcagtgctcttctgcctg agcgaggacaagaagaacatcatcctggaggagggcaaggagatcctggtgggcgacgtg ggccagaccgtggacgacccctacgccacctttgtcaagatgctgcccgacaaggactgc cgctacgccctctatgacgcgacctacgagaccaaggagagcaagaaggaagacctggtg ttcatcttctgggccccagagtctgcgcctcttaagagcaaaatgatctacgccagctcc aaggatgccatcaagaagaagctgacgggaatcaagcacgaattgcaagcaaactgctac gaggaggtcaaggaccgctgcaccctggcagagaagctggggggtagcgccgtcatctcc ctggagggcaagccgttgtga

DBGET integrated database retrieval system