Sorex fumeus (smoky shrew): 130040314 Help Entry 130040314         CDS       T10594                                  Name (RefSeq) histone H2B type 1-C/E/F/G/I   KO K11252   histone H2B Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04613   Neutrophil extracellular trap formation sfum05034   Alcoholism sfum05203   Viral carcinogenesis sfum05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:sfum00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     130040314  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     130040314   09163 Immune disease    05322 Systemic lupus erythematosus     130040314   09165 Substance dependence    05034 Alcoholism     130040314  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sfum03036]     130040314   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfum04147]     130040314 Chromosome and associated proteins [BR:sfum03036]  Eukaryotic type   Nucleosome assembly factors    Histones     130040314 Exosome [BR:sfum04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130040314 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  130040314 NCBI-ProteinID:  XP_055988321 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccggcgaagtccgctcccgccccaaagaagggctccaagaaggccgtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtgcaccccgacacgggcatctcgtccaaggctatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccggcgaggcgtcccgc ctggcgcactacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtaa

DBGET integrated database retrieval system