Sorex fumeus (smoky shrew): 130041314 Help Entry 130041314         CDS       T10594                                  Symbol ARF6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04014   Ras signaling pathway sfum04072   Phospholipase D signaling pathway sfum04144   Endocytosis sfum04517   IgSF CAM signaling sfum04666   Fc gamma R-mediated phagosome formation sfum05132   Salmonella infection sfum05135   Yersinia infection Brite KEGG Orthology (KO) [BR:sfum00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     130041314 (ARF6)    04072 Phospholipase D signaling pathway     130041314 (ARF6)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     130041314 (ARF6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     130041314 (ARF6)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagosome formation     130041314 (ARF6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     130041314 (ARF6)    05135 Yersinia infection     130041314 (ARF6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sfum04131]     130041314 (ARF6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfum04147]     130041314 (ARF6)    04031 GTP-binding proteins [BR:sfum04031]     130041314 (ARF6) Membrane trafficking [BR:sfum04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     130041314 (ARF6)   Arf GTPases and associated proteins    Arf GTPases     130041314 (ARF6) Exosome [BR:sfum04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130041314 (ARF6)   Exosomal proteins of colorectal cancer cells    130041314 (ARF6) GTP-binding proteins [BR:sfum04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     130041314 (ARF6) SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  130041314 NCBI-ProteinID:  XP_055989350 LinkDB All DBs Position Unknown AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaggtgctgtccaagatcttcggtaacaaggagatgcggatcctcatgctgggc ctggacgcggccggcaagaccacgatcctgtacaagttgaagctgggccagtcggtgacc accatccccacggtgggcttcaacgtggagacggtgacttacaaaaacgtcaagttcaac gtgtgggatgtgggcggccaggacaagatccggccgctgtggcggcactactacaccggg acccaggggctcatcttcgtggtggactgcgccgaccgcgaccgcatcgacgaggcccgc caggagctacaccgcatcatcaacgaccgggagatgcgggacgccatcatcctcatcttc gccaacaagcaggacctgcccgacgccatgaagccccacgagatccaggagaaactgggc ctgacccgcatccgggaccggaactggtatgtgcagccctcctgcgccaccacgggggac ggactctacgaggggctcacgtggttgacgtccaactacaagtcctaa

DBGET integrated database retrieval system