Sorex fumeus (smoky shrew): 130043296 Help Entry 130043296         CDS       T10594                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04613   Neutrophil extracellular trap formation sfum05034   Alcoholism sfum05202   Transcriptional misregulation in cancer sfum05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:sfum00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     130043296  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     130043296   09163 Immune disease    05322 Systemic lupus erythematosus     130043296   09165 Substance dependence    05034 Alcoholism     130043296  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sfum03036]     130043296   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfum04147]     130043296 Chromosome and associated proteins [BR:sfum03036]  Eukaryotic type   Nucleosome assembly factors    Histones     130043296 Exosome [BR:sfum04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130043296 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  130043296 NCBI-ProteinID:  XP_055962499 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgcaccaagcagaccgcgcgcaagtccaccggcggcaaggcgccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtcaagaagccgcac cgctaccggccgggcaccgtggcgctgcgcgagatccgccgctaccagaagtccacggag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggccagcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggggagcgggcctga

DBGET integrated database retrieval system