Sorex fumeus (smoky shrew): 130043691 Help Entry 130043691         CDS       T10594                                  Name (RefSeq) C-C motif chemokine 22-like   KO K21095   C-C motif chemokine 22 Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04060   Cytokine-cytokine receptor interaction sfum04061   Viral protein interaction with cytokine and cytokine receptor sfum04062   Chemokine signaling pathway sfum04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:sfum00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     130043691    04061 Viral protein interaction with cytokine and cytokine receptor     130043691  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     130043691    04062 Chemokine signaling pathway     130043691  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sfum04052]     130043691 Cytokines and neuropeptides [BR:sfum04052]  Cytokines   Chemokines    130043691 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  130043691 NCBI-ProteinID:  XP_055992085 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MATQHTWLLATLALLAVVLGVTEAGPYAANVEDSTCCRAYTRRPLPLVAVKDFYWTSLSC RRPGVVLLTVKNLEICADPSQAWVKRIIRKLGRGGKMPV NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggccactcagcacacctggctcctggccaccttggccctcctcgctgtggtccttgga gtgactgaggctggcccctacgccgccaatgtggaggacagcacctgctgcagggcctac acccgccgcccgctgcccttggtcgccgtgaaggacttctactggacttccctctcctgc cggaggcctggcgtggtcttactgaccgtcaagaacctggagatctgcgcggaccccagc caggcctgggtgaagaggatcatccggaagttgggcaggggaggaaagatgccggtctga

DBGET integrated database retrieval system