Sorex fumeus (smoky shrew): 130044056 Help Entry 130044056         CDS       T10594                                  Name (RefSeq) metallothionein-2A-like   KO K14739   metallothionein 1/2 Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04978   Mineral absorption Brite KEGG Orthology (KO) [BR:sfum00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     130044056  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sfum03019]     130044056    03029 Mitochondrial biogenesis [BR:sfum03029]     130044056 Messenger RNA biogenesis [BR:sfum03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      130044056 Mitochondrial biogenesis [BR:sfum03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     130044056 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  130044056 NCBI-ProteinID:  XP_055992608 LinkDB All DBs Position Unknown AA seq 62 aa AA seqDB search MDPNCSGCAGGACTCADSCKCKDCKCGSCKKSCCSCCPAGCAKCAQGCVCKGASSDKCSC CA NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctccggctgcgctggcggcgcctgcacctgcgcggactcctgcaag tgcaaagactgcaaatgcggctcctgcaagaagagctgctgctcctgctgccccgcgggc tgtgccaagtgtgcccagggctgtgtgtgcaaaggggcgtcgtcggacaagtgcagctgc tgcgcctga

DBGET integrated database retrieval system