KEGG   Sorex fumeus (smoky shrew): 130045948
Entry
130045948         CDS       T10594                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sfum  Sorex fumeus (smoky shrew)
Pathway
sfum01521  EGFR tyrosine kinase inhibitor resistance
sfum01522  Endocrine resistance
sfum01524  Platinum drug resistance
sfum04010  MAPK signaling pathway
sfum04012  ErbB signaling pathway
sfum04014  Ras signaling pathway
sfum04015  Rap1 signaling pathway
sfum04022  cGMP-PKG signaling pathway
sfum04024  cAMP signaling pathway
sfum04062  Chemokine signaling pathway
sfum04066  HIF-1 signaling pathway
sfum04068  FoxO signaling pathway
sfum04071  Sphingolipid signaling pathway
sfum04072  Phospholipase D signaling pathway
sfum04114  Oocyte meiosis
sfum04140  Autophagy - animal
sfum04148  Efferocytosis
sfum04150  mTOR signaling pathway
sfum04151  PI3K-Akt signaling pathway
sfum04210  Apoptosis
sfum04218  Cellular senescence
sfum04261  Adrenergic signaling in cardiomyocytes
sfum04270  Vascular smooth muscle contraction
sfum04350  TGF-beta signaling pathway
sfum04360  Axon guidance
sfum04370  VEGF signaling pathway
sfum04371  Apelin signaling pathway
sfum04380  Osteoclast differentiation
sfum04510  Focal adhesion
sfum04517  IgSF CAM signaling
sfum04520  Adherens junction
sfum04540  Gap junction
sfum04550  Signaling pathways regulating pluripotency of stem cells
sfum04611  Platelet activation
sfum04613  Neutrophil extracellular trap formation
sfum04620  Toll-like receptor signaling pathway
sfum04621  NOD-like receptor signaling pathway
sfum04625  C-type lectin receptor signaling pathway
sfum04650  Natural killer cell mediated cytotoxicity
sfum04657  IL-17 signaling pathway
sfum04658  Th1 and Th2 cell differentiation
sfum04659  Th17 cell differentiation
sfum04660  T cell receptor signaling pathway
sfum04662  B cell receptor signaling pathway
sfum04664  Fc epsilon RI signaling pathway
sfum04666  Fc gamma R-mediated phagocytosis
sfum04668  TNF signaling pathway
sfum04713  Circadian entrainment
sfum04720  Long-term potentiation
sfum04722  Neurotrophin signaling pathway
sfum04723  Retrograde endocannabinoid signaling
sfum04724  Glutamatergic synapse
sfum04725  Cholinergic synapse
sfum04726  Serotonergic synapse
sfum04730  Long-term depression
sfum04810  Regulation of actin cytoskeleton
sfum04910  Insulin signaling pathway
sfum04912  GnRH signaling pathway
sfum04914  Progesterone-mediated oocyte maturation
sfum04915  Estrogen signaling pathway
sfum04916  Melanogenesis
sfum04917  Prolactin signaling pathway
sfum04919  Thyroid hormone signaling pathway
sfum04921  Oxytocin signaling pathway
sfum04926  Relaxin signaling pathway
sfum04928  Parathyroid hormone synthesis, secretion and action
sfum04929  GnRH secretion
sfum04930  Type II diabetes mellitus
sfum04933  AGE-RAGE signaling pathway in diabetic complications
sfum04934  Cushing syndrome
sfum04935  Growth hormone synthesis, secretion and action
sfum04960  Aldosterone-regulated sodium reabsorption
sfum05010  Alzheimer disease
sfum05020  Prion disease
sfum05022  Pathways of neurodegeneration - multiple diseases
sfum05034  Alcoholism
sfum05132  Salmonella infection
sfum05133  Pertussis
sfum05135  Yersinia infection
sfum05140  Leishmaniasis
sfum05142  Chagas disease
sfum05145  Toxoplasmosis
sfum05152  Tuberculosis
sfum05160  Hepatitis C
sfum05161  Hepatitis B
sfum05163  Human cytomegalovirus infection
sfum05164  Influenza A
sfum05165  Human papillomavirus infection
sfum05166  Human T-cell leukemia virus 1 infection
sfum05167  Kaposi sarcoma-associated herpesvirus infection
sfum05170  Human immunodeficiency virus 1 infection
sfum05171  Coronavirus disease - COVID-19
sfum05200  Pathways in cancer
sfum05203  Viral carcinogenesis
sfum05205  Proteoglycans in cancer
sfum05206  MicroRNAs in cancer
sfum05207  Chemical carcinogenesis - receptor activation
sfum05208  Chemical carcinogenesis - reactive oxygen species
sfum05210  Colorectal cancer
sfum05211  Renal cell carcinoma
sfum05212  Pancreatic cancer
sfum05213  Endometrial cancer
sfum05214  Glioma
sfum05215  Prostate cancer
sfum05216  Thyroid cancer
sfum05218  Melanoma
sfum05219  Bladder cancer
sfum05220  Chronic myeloid leukemia
sfum05221  Acute myeloid leukemia
sfum05223  Non-small cell lung cancer
sfum05224  Breast cancer
sfum05225  Hepatocellular carcinoma
sfum05226  Gastric cancer
sfum05230  Central carbon metabolism in cancer
sfum05231  Choline metabolism in cancer
sfum05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sfum05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sfum00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    130045948 (MAPK3)
   04012 ErbB signaling pathway
    130045948 (MAPK3)
   04014 Ras signaling pathway
    130045948 (MAPK3)
   04015 Rap1 signaling pathway
    130045948 (MAPK3)
   04350 TGF-beta signaling pathway
    130045948 (MAPK3)
   04370 VEGF signaling pathway
    130045948 (MAPK3)
   04371 Apelin signaling pathway
    130045948 (MAPK3)
   04668 TNF signaling pathway
    130045948 (MAPK3)
   04066 HIF-1 signaling pathway
    130045948 (MAPK3)
   04068 FoxO signaling pathway
    130045948 (MAPK3)
   04072 Phospholipase D signaling pathway
    130045948 (MAPK3)
   04071 Sphingolipid signaling pathway
    130045948 (MAPK3)
   04024 cAMP signaling pathway
    130045948 (MAPK3)
   04022 cGMP-PKG signaling pathway
    130045948 (MAPK3)
   04151 PI3K-Akt signaling pathway
    130045948 (MAPK3)
   04150 mTOR signaling pathway
    130045948 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    130045948 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    130045948 (MAPK3)
   04148 Efferocytosis
    130045948 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    130045948 (MAPK3)
   04210 Apoptosis
    130045948 (MAPK3)
   04218 Cellular senescence
    130045948 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    130045948 (MAPK3)
   04520 Adherens junction
    130045948 (MAPK3)
   04540 Gap junction
    130045948 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    130045948 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    130045948 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    130045948 (MAPK3)
   04613 Neutrophil extracellular trap formation
    130045948 (MAPK3)
   04620 Toll-like receptor signaling pathway
    130045948 (MAPK3)
   04621 NOD-like receptor signaling pathway
    130045948 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    130045948 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    130045948 (MAPK3)
   04660 T cell receptor signaling pathway
    130045948 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    130045948 (MAPK3)
   04659 Th17 cell differentiation
    130045948 (MAPK3)
   04657 IL-17 signaling pathway
    130045948 (MAPK3)
   04662 B cell receptor signaling pathway
    130045948 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    130045948 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    130045948 (MAPK3)
   04062 Chemokine signaling pathway
    130045948 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    130045948 (MAPK3)
   04929 GnRH secretion
    130045948 (MAPK3)
   04912 GnRH signaling pathway
    130045948 (MAPK3)
   04915 Estrogen signaling pathway
    130045948 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    130045948 (MAPK3)
   04917 Prolactin signaling pathway
    130045948 (MAPK3)
   04921 Oxytocin signaling pathway
    130045948 (MAPK3)
   04926 Relaxin signaling pathway
    130045948 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    130045948 (MAPK3)
   04919 Thyroid hormone signaling pathway
    130045948 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    130045948 (MAPK3)
   04916 Melanogenesis
    130045948 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    130045948 (MAPK3)
   04270 Vascular smooth muscle contraction
    130045948 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    130045948 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    130045948 (MAPK3)
   04725 Cholinergic synapse
    130045948 (MAPK3)
   04726 Serotonergic synapse
    130045948 (MAPK3)
   04720 Long-term potentiation
    130045948 (MAPK3)
   04730 Long-term depression
    130045948 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    130045948 (MAPK3)
   04722 Neurotrophin signaling pathway
    130045948 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    130045948 (MAPK3)
   04380 Osteoclast differentiation
    130045948 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    130045948 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    130045948 (MAPK3)
   05206 MicroRNAs in cancer
    130045948 (MAPK3)
   05205 Proteoglycans in cancer
    130045948 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    130045948 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    130045948 (MAPK3)
   05203 Viral carcinogenesis
    130045948 (MAPK3)
   05230 Central carbon metabolism in cancer
    130045948 (MAPK3)
   05231 Choline metabolism in cancer
    130045948 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    130045948 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    130045948 (MAPK3)
   05212 Pancreatic cancer
    130045948 (MAPK3)
   05225 Hepatocellular carcinoma
    130045948 (MAPK3)
   05226 Gastric cancer
    130045948 (MAPK3)
   05214 Glioma
    130045948 (MAPK3)
   05216 Thyroid cancer
    130045948 (MAPK3)
   05221 Acute myeloid leukemia
    130045948 (MAPK3)
   05220 Chronic myeloid leukemia
    130045948 (MAPK3)
   05218 Melanoma
    130045948 (MAPK3)
   05211 Renal cell carcinoma
    130045948 (MAPK3)
   05219 Bladder cancer
    130045948 (MAPK3)
   05215 Prostate cancer
    130045948 (MAPK3)
   05213 Endometrial cancer
    130045948 (MAPK3)
   05224 Breast cancer
    130045948 (MAPK3)
   05223 Non-small cell lung cancer
    130045948 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    130045948 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    130045948 (MAPK3)
   05161 Hepatitis B
    130045948 (MAPK3)
   05160 Hepatitis C
    130045948 (MAPK3)
   05171 Coronavirus disease - COVID-19
    130045948 (MAPK3)
   05164 Influenza A
    130045948 (MAPK3)
   05163 Human cytomegalovirus infection
    130045948 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    130045948 (MAPK3)
   05165 Human papillomavirus infection
    130045948 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    130045948 (MAPK3)
   05135 Yersinia infection
    130045948 (MAPK3)
   05133 Pertussis
    130045948 (MAPK3)
   05152 Tuberculosis
    130045948 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    130045948 (MAPK3)
   05140 Leishmaniasis
    130045948 (MAPK3)
   05142 Chagas disease
    130045948 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    130045948 (MAPK3)
   05020 Prion disease
    130045948 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    130045948 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    130045948 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    130045948 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    130045948 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    130045948 (MAPK3)
   04934 Cushing syndrome
    130045948 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    130045948 (MAPK3)
   01524 Platinum drug resistance
    130045948 (MAPK3)
   01522 Endocrine resistance
    130045948 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfum01001]
    130045948 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sfum03036]
    130045948 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfum04147]
    130045948 (MAPK3)
Enzymes [BR:sfum01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     130045948 (MAPK3)
Protein kinases [BR:sfum01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   130045948 (MAPK3)
Chromosome and associated proteins [BR:sfum03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     130045948 (MAPK3)
Exosome [BR:sfum04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   130045948 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 130045948
NCBI-ProteinID: XP_055994809
LinkDB
Position
Unknown
AA seq 415 aa
MAAPAAAAQGGGGGEPRGADGVVPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSS
AYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDV
YIVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTC
DLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEM
LSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPK
SDAKALDLLDRMLTFNPNKRITVEEALAHPYVDQYYDPTDEVGSCWWQAGGRWGDRVDGG
GSLSPCRGLASLPPQPVAEEPFTFDMELDDLPKEQLKELIFQETAPFQPGARETP
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggcggcgccggcggcggctgctcaggggggcgggggcggggagccccggggcgccgac
ggggtggtcccgggggtccccggggaagtggagatggtgaaggggcagccgttcgacgtg
ggcccgcgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctca
gcttacgaccacgtgcgcaagacccgagtggccatcaagaaaatcagccccttcgagcat
cagacctactgtcagcgcaccctgcgagagattcagatcttgctacgcttccgccacgag
aatgtcatcggcatccgggacatcctgcgggcccccaccctggaagccatgagggatgtc
tatattgtgcaggacctgatggagacagacctatacaagttgctcaaaagccagcagctg
agcaacgaccatgtctgctacttcctgtaccagatcctgcggggcctaaagtatatccac
tcagccaatgtgctccaccgggacttaaagccctccaacctgctcatcaacaccacctgc
gaccttaagatctgcgattttggcctggcccggattgctgatcctgagcacgaccacacg
ggcttcctaacagaatacgtggcgacgcgctggtaccgggcccctgagatcatgctcaat
tccaagggctataccaagtccattgacatctggtctgtgggctgcatcttggctgagatg
ctctccaaccggcccatcttccccggcaagcactacctagaccagctcaaccacattctg
ggtatcctgggctcgccatcgcaggaagacctgaattgtatcatcaacatgaaggcccgg
aactacttacagtctcttccctccaagaccaaagtggcctgggccaagctttttcccaag
tcagatgccaaagcccttgacctgctggaccggatgttgacttttaaccccaacaaacgg
atcacggtggaggaagctctggctcatccctatgtggaccagtactatgatccgacggat
gaggtgggaagctgctggtggcaggcaggtggcaggtggggggatagagtggatggaggc
gggtctctcagtccctgccgtggccttgcttctcttcccccgcagcccgtggccgaggag
cctttcacctttgacatggagctggacgacctacccaaggagcagctgaaggagctcatc
tttcaggaaacagccccctttcagccgggagcccgggagaccccctaa

DBGET integrated database retrieval system