Sorex fumeus (smoky shrew): 130046135 Help Entry 130046135         CDS       T10594                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum04613   Neutrophil extracellular trap formation sfum05034   Alcoholism sfum05202   Transcriptional misregulation in cancer sfum05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:sfum00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     130046135  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     130046135   09163 Immune disease    05322 Systemic lupus erythematosus     130046135   09165 Substance dependence    05034 Alcoholism     130046135  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sfum03036]     130046135   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfum04147]     130046135 Chromosome and associated proteins [BR:sfum03036]  Eukaryotic type   Nucleosome assembly factors    Histones     130046135 Exosome [BR:sfum04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130046135 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  130046135 NCBI-ProteinID:  XP_055995017 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaagtcgaccggtggtaaagcaccgaggaagcaa ctggctacaaaagccgctcgcaagagcgcgccctctaccggaggggtgaagaagcctcac cgttacaggcctggtactgtggcactccgtgaaattaggcgctatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcaggacttcaaa acagatctgcgcttccagagcgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagataccaacctgtgtgctattcatgccaaacgtgtaacaatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system