Shigella flexneri 8401 (serotype 5b): SFV_1011 Help Entry SFV_1011          CDS       T00377                                  Symbol yccD Name (GenBank) conserved hypothetical protein   KO K18997   chaperone modulatory protein CbpM Organism sfv  Shigella flexneri 8401 (serotype 5b) Brite KEGG Orthology (KO) [BR:sfv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sfv03036]     SFV_1011 (yccD) Chromosome and associated proteins [BR:sfv03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     SFV_1011 (yccD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MerR_2 TSC22 Sas6_CC Motif Other DBs NCBI-ProteinID:  ABF03230 UniProt:  Q0T635 LinkDB All DBs Position complement(1059435..1059740) Genome browser AA seq 101 aa AA seqDB search MANVTVTFTITEFCLHTGISEEELNEIVGLGVVEPREIQETTWVFDDHAAIVVQRAVRLR HELALDWPGIAVALTLMDDIAHLKQENRLLRQRLSRFVAHP NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggctaatgttacggtgacttttactattaccgaattttgcctgcataccggcatctct gaagaggagttgaatgaaattgtcggtttgggggtggttgaaccgcgtgagatccaggaa acaacctgggtatttgacgaccatgccgccattgtggtgcaacgcgcggtacgcctgcgt catgaactggctctggactggccggggatcgcggtggcgctgacgttaatggatgatatt gcgcacctgaagcaggaaaaccgcctgctacgccagcggctttcccggtttgtagctcat ccgtga

DBGET integrated database retrieval system