Shigella flexneri 8401 (serotype 5b): SFV_1123 Help Entry SFV_1123          CDS       T00377                                  Symbol ycfF Name (GenBank) conserved hypothetical protein   KO K02503   histidine triad (HIT) family protein [EC:3.9.1.-] Organism sfv  Shigella flexneri 8401 (serotype 5b) Brite KEGG Orthology (KO) [BR:sfv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:sfv03016]     SFV_1123 (ycfF)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sfv04147]     SFV_1123 (ycfF) Transfer RNA biogenesis [BR:sfv03016]  Eukaryotic type   Aminoacyl-tRNA synthetases (AARSs)    AARS associated factors     SFV_1123 (ycfF) Exosome [BR:sfv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    SFV_1123 (ycfF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HIT DcpS_C Motif Other DBs NCBI-ProteinID:  ABF03332 UniProt:  Q0T5T3 LinkDB All DBs Position 1167682..1168041 Genome browser AA seq 119 aa AA seqDB search MAEETIFSKIIRREIPSDIVYQDDLVTAFRDISPQAPTHILIIPNILIPTVNDVSAEHEQ ALGRMITVAAKIAEQEGIAEDGYRLIMNTNRHGGQEVYHIHMHLLGGRPLGPMLAHKGL NT seq 360 nt NT seq  +upstreamnt  +downstreamnt gtggcagaagaaactatattcagcaaaattattcgtcgtgagatcccctccgatatcgtc taccaggatgatctggtaacggcgtttcgcgatatttcgccgcaagcgccaacgcatatt ctgatcattccgaatattctcattccgactgtgaacgacgtgtcagctgagcatgagcag gcgctgggacgcatgatcaccgtagcggcaaaaattgctgagcaagaaggtattgccgaa gatggctatcgtctgatcatgaataccaaccgccatggcggacaagaggtttaccacatc catatgcacttgttgggtggccgtccgctgggaccaatgctggcgcataaaggtctgtaa

DBGET integrated database retrieval system