Shigella flexneri 8401 (serotype 5b): SFV_2750 Help Entry SFV_2750          CDS       T00377                                  Name (GenBank) conserved hypothetical protein   KO K05589   cell division protein FtsB Organism sfv  Shigella flexneri 8401 (serotype 5b) Brite KEGG Orthology (KO) [BR:sfv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sfv03036]     SFV_2750 Chromosome and associated proteins [BR:sfv03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     SFV_2750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC ZapB XRCC4_CC Motif Other DBs NCBI-ProteinID:  ABF04836 UniProt:  Q0T1H9 LinkDB All DBs Position 2819061..2819372 Genome browser AA seq 103 aa AA seqDB search MGKLTLLLLAILVWLQYSLWFGKNGIHDYTRVNDDVAALQATNAKLKARNDQLFAEIDDL NGGQEALEERARNELSMTRPGETFYRLVPDASKRAQSAGQNNR NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgggtaaactaacgctgctgttgctggctattctggtctggctacagtattcgctgtgg ttcggtaagaacggtatacatgactatacccgcgtcaatgatgatgtggcggcactgcaa gctacaaacgcgaaacttaaagcgcgaaacgatcaactttttgccgaaattgacgatctc aatggcggccaggaggcgctcgaagagcgtgcgcgtaatgaactcagcatgaccaggccg ggcgaaactttttatcgtctggtgcctgacgcgtcgaagcgcgcacagtctgcggggcaa aacaatcgataa

DBGET integrated database retrieval system