Shigella flexneri 8401 (serotype 5b): SFV_3662 Help Entry SFV_3662          CDS       T00377                                  Name (GenBank) conserved hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism sfv  Shigella flexneri 8401 (serotype 5b) Pathway sfv03060   Protein export sfv03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:sfv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SFV_3662  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     SFV_3662  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:sfv02044]     SFV_3662 Secretion system [BR:sfv02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    SFV_3662 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E DUF4834 Motif Other DBs NCBI-ProteinID:  ABF05687 UniProt:  Q0SZ28 LinkDB All DBs Position complement(3748314..3748625) Genome browser AA seq 103 aa AA seqDB search MRLCLIIIYHRGTCMGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDD EPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDAKRHDKEQV NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgcggctttgtttaatcatcatctaccacagaggaacatgtatgggtggtatcagtatt tggcagttattgattattgccgtcatcgttgtactgctttttggcaccaaaaagctcggc tccatcggttccgatcttggtgcgtcgatcaaaggctttaaaaaagcaatgagcgatgat gaaccaaagcaggataaaaccagtcaggatgctgattttactgcgaaaactatcgccgat aagcaggcggatacgaatcaggaacaggctaaaacagaagacgcgaagcgccacgataaa gagcaggtgtaa

DBGET integrated database retrieval system