Shigella flexneri 8401 (serotype 5b): SFV_3922 Help Entry SFV_3922          CDS       T00377                                  Symbol secB Name (GenBank) export protein SecB   KO K03071   preprotein translocase subunit SecB Organism sfv  Shigella flexneri 8401 (serotype 5b) Pathway sfv02024   Quorum sensing sfv03060   Protein export sfv03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:sfv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SFV_3922 (secB)  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     SFV_3922 (secB)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     SFV_3922 (secB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sfv03110]     SFV_3922 (secB)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:sfv02044]     SFV_3922 (secB) Chaperones and folding catalysts [BR:sfv03110]  Other chaperones and cochaperones   SecB    SFV_3922 (secB) Secretion system [BR:sfv02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    SFV_3922 (secB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecB Motif Other DBs NCBI-ProteinID:  ABF05930 UniProt:  Q0SYD5 LinkDB All DBs Position 4023300..4023767 Genome browser AA seq 155 aa AA seqDB search MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVL RVTVTASLGEETAFLCEVQQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSR GTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcagaacaaaacaacactgaaatgactttccagatccaacgtatttataccaaggat atctctttcgaagcgccgaacgcgccgcacgttttccagaaagattggcaaccagaagtt aaacttgatctggatacggcatcttcccaactggcagatgacgtatacgaagtggtactg cgtgttaccgtaacggcctccttgggcgaagaaaccgcgttcctgtgtgaagttcagcag ggcggtattttctccatcgcgggtatcgaaggcacccagatggcacattgcctgggcgca tactgcccgaacattctgttcccgtatgctcgtgagtgcatcaccagcatggtatcccgc ggtacattcccgcaactgaaccttgcgccggttaacttcgatgcgctgttcatgaactat ttgcagcagcaggctggcgaaggtactgaagaacatcaggatgcctga

DBGET integrated database retrieval system