Shigella flexneri 8401 (serotype 5b): SFV_4330 Help Entry SFV_4330          CDS       T00377                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism sfv  Shigella flexneri 8401 (serotype 5b) Pathway sfv02024   Quorum sensing sfv03018   RNA degradation Brite KEGG Orthology (KO) [BR:sfv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     SFV_4330 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     SFV_4330 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sfv03019]     SFV_4330 (hfq)    03036 Chromosome and associated proteins [BR:sfv03036]     SFV_4330 (hfq) Messenger RNA biogenesis [BR:sfv03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      SFV_4330 (hfq) Chromosome and associated proteins [BR:sfv03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     SFV_4330 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ABF06305 UniProt:  Q0SXB0 LinkDB All DBs Position 4472960..4473268 Genome browser AA seq 102 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagatccgttcctgaacgcactgcgtcgggaacgtgtt ccagtttctatttatttggtgaatggtattaagctgcaagggcaaatcgagtcttttgat cagttcgtgatcctgttgaaaaacacggtcagccagatggtttacaagcacgcgatttct actgttgtcccatctcgcccggtttctcatcacagtaacaacgccggtggcggtaccagc agtaactaccatcatggtagcagcgcgcagaatacttccgcgcaacaggacagcgaagaa accgaataa

DBGET integrated database retrieval system