Serratia fonticola DSM 4576: WN53_09175 Help Entry WN53_09175        CDS       T04030                                  Name (GenBank) peptidylprolyl isomerase   KO K03769   peptidyl-prolyl cis-trans isomerase C [EC:5.2.1.8] Organism sfw  Serratia fonticola DSM 4576 Brite KEGG Orthology (KO) [BR:sfw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sfw03110]     WN53_09175 Enzymes [BR:sfw01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      WN53_09175 Chaperones and folding catalysts [BR:sfw03110]  Protein folding catalysts   Peptidyl prolyl isomerase    Parvulin     WN53_09175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rotamase_3 Rotamase Rotamase_2 DUF7067 Motif Other DBs NCBI-ProteinID:  AKG69267 UniProt:  A0A0F7HAP7 LinkDB All DBs Position complement(2075843..2076124) Genome browser AA seq 93 aa AA seqDB search MAKTASALHILVDNETLANELLAKLKRGVSFDTLARKYSSCPSKRNGGSLGEFNKGTMVA AFDKAVFSIPLLKPYGPVKTQFGYHIIKVLYRN NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggcaaagaccgctagcgcgctacacatcctggtggataacgaaacactagccaacgag ctgttggccaaactcaagcgcggcgtcagctttgatacgctggcgcgcaaatactcgagc tgcccgtccaaacgcaacggcggctccctgggtgagttcaacaaggggacgatggtcgct gccttcgataaggcagtgttcagcatcccgttgctcaagccctatggcccggtgaaaacc cagttcggctatcacatcatcaaggtactgtatcgcaactag

DBGET integrated database retrieval system