Serratia fonticola DSM 4576: WN53_18315 Help Entry WN53_18315        CDS       T04030                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism sfw  Serratia fonticola DSM 4576 Pathway sfw01100   Metabolic pathways sfw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WN53_18315    00074 Mycolic acid biosynthesis     WN53_18315   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WN53_18315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKG70920 LinkDB All DBs Position 4132684..4132968 Genome browser AA seq 94 aa AA seqDB search MLPTRINKRFREMQNKINEIIISCLACEESDITPDKDLFMDLYVDSLALADIIFTTGECF CFEFTEDDIDMISTVESIYHIVAKKTNIYSEHLH NT seq 285 nt NT seq  +upstreamnt  +downstreamnt ttgcttcccacaaggataaataagagatttagagaaatgcaaaataaaataaatgaaatc ataatttcctgtttagcttgcgaagaaagtgatataacacctgacaaagatctctttatg gatttatatgtggattcattagcattggctgacattattttcaccacgggagagtgtttt tgtttcgaatttacggaggatgatattgatatgattagtacggttgagtcaatttatcat atagtcgctaaaaaaactaatatttattcagagcacttgcattga

DBGET integrated database retrieval system