Serratia fonticola DSM 4576: WN53_19170 Help Entry WN53_19170        CDS       T04030                                  Name (GenBank) damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism sfw  Serratia fonticola DSM 4576 Brite KEGG Orthology (KO) [BR:sfw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:sfw03400]     WN53_19170 DNA repair and recombination proteins [BR:sfw03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     WN53_19170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI DUF5388 Motif Other DBs NCBI-ProteinID:  AKG71071 LinkDB All DBs Position complement(4325317..4325556) Genome browser AA seq 79 aa AA seqDB search MRVEVTIDKTKPLPPGAIEALTGEFSKRVNRQFPNTTVQIRYAGANGLSVMGGAKTDKDL IEEILQETWESADDWFSAE NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgcgtgttgaagtcactatagataaaaccaaaccactgccgccgggggcaatcgaagcc ctgaccggcgaattcagtaaacgggtcaatcgccagtttcctaacactaccgtccagatc cgttatgccggtgccaatggcctttcagtaatgggcggtgccaaaacagataaagacctg atcgaggagatactccaggaaacctgggaaagtgccgacgattggttcagtgcagaataa

DBGET integrated database retrieval system