Serratia fonticola DSM 4576: WN53_24950 Help Entry WN53_24950        CDS       T04030                                  Name (GenBank) DNA polymerase II   KO K02345   DNA polymerase III subunit theta [EC:2.7.7.7] Organism sfw  Serratia fonticola DSM 4576 Pathway sfw03030   DNA replication sfw03430   Mismatch repair sfw03440   Homologous recombination Brite KEGG Orthology (KO) [BR:sfw00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     WN53_24950    03430 Mismatch repair     WN53_24950    03440 Homologous recombination     WN53_24950  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sfw03032]     WN53_24950    03400 DNA repair and recombination proteins [BR:sfw03400]     WN53_24950 Enzymes [BR:sfw01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      WN53_24950 DNA replication proteins [BR:sfw03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      WN53_24950 DNA repair and recombination proteins [BR:sfw03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      WN53_24950 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol3_theta Motif Other DBs NCBI-ProteinID:  AKG72108 UniProt:  A0A0F7HFH3 LinkDB All DBs Position 5606274..5606477 Genome browser AA seq 67 aa AA seqDB search MPRPLDGLPQQERERIQTDLLALRIIYSERYGYAAEWESAETHVPTHLRGYFQQRLNFYR TAQRHSI NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgccacgaccactggatggcctaccccagcaagaacgtgaaaggatccaaaccgatttg ctggcactcagaattatttatagcgaacgctacggctacgccgccgaatgggaaagcgcc gaaacgcacgtccccacgcatctacgcggctactttcagcaacggctgaacttctatcgt actgcgcagcgccactcaatttaa

DBGET integrated database retrieval system