Shigella flexneri 2457T (serotype 2a): S1178 Help Entry S1178             CDS       T00128                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sfx  Shigella flexneri 2457T (serotype 2a) Pathway sfx01100   Metabolic pathways sfx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     S1178 (acpP)    00074 Mycolic acid biosynthesis     S1178 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     S1178 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AAP16605 UniProt:  P0A6B3 LinkDB All DBs Position 1142224..1142460 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system