Shigella flexneri 2457T (serotype 2a): S2328 Help Entry S2328             CDS       T00128                                  Name (GenBank) DNA-damage-inducible protein   KO K12149   DNA-damage-inducible protein I Organism sfx  Shigella flexneri 2457T (serotype 2a) Brite KEGG Orthology (KO) [BR:sfx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:sfx03400]     S2328 DNA repair and recombination proteins [BR:sfx03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     S2328 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI MAPKK1_Int Motif Other DBs NCBI-ProteinID:  AAP17543 UniProt:  A0A658Y3J7 LinkDB All DBs Position 2208343..2208591 Genome browser AA seq 82 aa AA seqDB search MRVEICIAKEKITKMPNGAVDALKEELTRRISKRYDDVEVIVKATSNDGLSVTRTADKDS AKTFVQETLKDTWESADEWFVH NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcgtgttgagatctgtatcgctaaagaaaaaatcactaaaatgccaaacggtgctgtg gatgcgttaaaggaagaattaacccgacgcatcagtaaacgttatgacgatgtagaggtg atcgtaaaagccaccagcaacgatggcctttctgttacacgcaccgcagataaggattct gcaaaaacatttgttcaggagactctgaaagatacctgggagtctgctgacgagtggttt gttcactaa

DBGET integrated database retrieval system