Shigella flexneri 2457T (serotype 2a): S2964 Help Entry S2964             CDS       T00128                                  Name (GenBank) hypothetical protein   KO K05589   cell division protein FtsB Organism sfx  Shigella flexneri 2457T (serotype 2a) Brite KEGG Orthology (KO) [BR:sfx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sfx03036]     S2964 Chromosome and associated proteins [BR:sfx03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     S2964 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC ZapB XRCC4_CC Motif Other DBs NCBI-ProteinID:  AAP18086 UniProt:  Q83JY0 LinkDB All DBs Position complement(2839350..2839661) Genome browser AA seq 103 aa AA seqDB search MGKLTLLLLAILVWLQYSLWFGKNGIHDYTRVNDDVAALQATNAKLKARNDQLFAEIDDL NGGQEALEERARNELSMTRPGETFYRLVPDASKRAQSAGQNNR NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgggtaaactaacgctgctgttgctggctattctggtctggctacagtattcgctgtgg ttcggtaagaacggtatacatgactatacccgcgtcaatgatgatgtggcggcactgcaa gctacaaacgcgaaacttaaagcgcgaaacgatcaactttttgccgaaattgacgatctc aatggcggccaggaggcgctcgaagagcgtgcgcgtaatgaactcagcatgaccaggccg ggcgaaactttttatcgtctggtgcctgacgcgtcgaagcgcgcacagtctgcggggcaa aacaatcgataa

DBGET integrated database retrieval system