Shigella flexneri 2457T (serotype 2a): S3224 Help Entry S3224             CDS       T00128                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism sfx  Shigella flexneri 2457T (serotype 2a) Pathway sfx01100   Metabolic pathways sfx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     S3224    00074 Mycolic acid biosynthesis     S3224   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     S3224 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 BH4 Motif Other DBs NCBI-ProteinID:  AAP18312 UniProt:  A0A9P2MYU7 LinkDB All DBs Position 3110011..3110259 Genome browser AA seq 82 aa AA seqDB search MVNREIVMDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPIN ILLDVKTPAQLMETLLPWLENK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtaaatcgtgaaatagtaatggattacatcctttcctgtttacaggatttggtcgaa aacggtgtggaaattaagcccgacagcgatctcgtcaacgatcttggcctggagtcgatc aaagtgatggatctcttaatgatgctggaagacagattcgatatttccattcctattaat attctgctggatgtcaaaacccctgcgcaattaatggaaactctacttccatggctggag aataaataa

DBGET integrated database retrieval system