Shigella flexneri 2457T (serotype 2a): S4119 Help Entry S4119             CDS       T00128                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism sfx  Shigella flexneri 2457T (serotype 2a) Brite KEGG Orthology (KO) [BR:sfx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sfx03110]     S4119 (grxC) Chaperones and folding catalysts [BR:sfx03110]  Protein folding catalysts   Protein disulfide isomerase    S4119 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like GST_N_2 SH3BGR GST_N Thioredoxin_2 Thioredoxin_3 CLIC-like_N Motif Other DBs NCBI-ProteinID:  AAP19096 UniProt:  A0A9P2N192 LinkDB All DBs Position 4018179..4018430 Genome browser AA seq 83 aa AA seqDB search MANVEIYTKETCPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGCTTVPQIFIDA QHIGGCDDLYALDARGGLDPLLK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggccaatgttgaaatctataccaaagaaacctgcccgtattgccatcgtgcaaaagca ctgctgagcagcaagggcgtgagtttccaggagttgccgatcgatggcaatgccgccaag cgtgaagagatgatcaaacgcagcggttgcaccacggttccccagatttttattgacgca cagcacattggcggctgtgatgacttgtatgcattggatgcacgtggtggactggatccc ctgctgaaataa

DBGET integrated database retrieval system