Streptococcus gallolyticus UCN34: GALLO_0024 Help Entry GALLO_0024        CDS       T01171                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism sga  Streptococcus gallolyticus UCN34 Pathway sga01100   Metabolic pathways sga01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sga00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GALLO_0024    00074 Mycolic acid biosynthesis     GALLO_0024   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GALLO_0024 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  CBI12516 UniProt:  A0AA36JVT5 LinkDB All DBs Position 32161..32403 Genome browser AA seq 80 aa AA seqDB search MTKEAIFERICFIIKEQLHKPELNITQTTTLHDDLGVDSIALMEFIINLEDEFHLEIPDE DVENMKCMGEMMEYLYNRVN NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacaaaagaggctatttttgaaaggatttgcttcattattaaggagcaattgcataaa ccagagttaaatattactcaaacgacaactttacatgatgatttgggagttgattcgatt gccttaatggaatttatcatcaatttagaagatgagtttcatttggaaatccctgacgaa gatgttgaaaacatgaaatgtatgggagaaatgatggaatatctctataatcgcgtaaat taa

DBGET integrated database retrieval system