Streptomyces galilaeus: CP966_12775 Help Entry CP966_12775       CDS       T06932                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sgal  Streptomyces galilaeus Pathway sgal00998   Biosynthesis of various antibiotics sgal01100   Metabolic pathways sgal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgal00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CP966_12775    00074 Mycolic acid biosynthesis     CP966_12775   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CP966_12775 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEU70146 LinkDB All DBs Position 2807927..2808157 Genome browser AA seq 76 aa AA seqDB search MIAEAARLDAAVVAGLPADTDLFGPEIGLTSLAGVTLLGAVDARFGVDVAALDLSLDSLQ SIATLADFVTAHRSAR NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgatcgcggaggccgcccgcctggacgccgccgtggtcgccggacttcccgccgacacc gacctgttcggcccggagatcggcctgacctcgctcgccggggtgacgctgctgggcgcg gtggacgcccgcttcggcgtcgatgtcgccgcgctggacctcagcctggacagtctccag tccatcgccaccctggccgacttcgtgacggcgcaccggagcgcccgctga

DBGET integrated database retrieval system