Streptomyces galilaeus: CP966_24095 Help Entry CP966_24095       CDS       T06932                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism sgal  Streptomyces galilaeus Brite KEGG Orthology (KO) [BR:sgal00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     CP966_24095 Enzymes [BR:sgal01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      CP966_24095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 Thioredoxin Glrx-like GST_N_3 IU_nuc_hydro Motif Other DBs NCBI-ProteinID:  QEU67981 UniProt:  A0A5J6EVY1 LinkDB All DBs Position complement(5254981..5255223) Genome browser AA seq 80 aa AA seqDB search MPGTVTMYSTTWCGYCRRLKGQMDREGITYNEINIEQDPESAAFVEKANGGNQTVPTVLF PDGSTLTNPSLAQVKQKIGA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgccgggcactgtgacgatgtacagcaccacgtggtgcggctactgccgcaggttgaag ggccagatggaccgcgagggcatcacgtacaacgagatcaacatcgagcaggacccggag tccgcggcgttcgtggagaaggcgaatggcggaaaccagacggtgccgaccgtgctgttc cctgacggctccacgctgacgaacccttcgctggctcaggtcaagcagaagatcggcgcg taa

DBGET integrated database retrieval system