Streptomyces galilaeus: CP966_29080 Help Entry CP966_29080       CDS       T06932                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism sgal  Streptomyces galilaeus Pathway sgal00253   Tetracycline biosynthesis sgal01056   Biosynthesis of type II polyketide backbone sgal01100   Metabolic pathways sgal01110   Biosynthesis of secondary metabolites Module sgal_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:sgal00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     CP966_29080    00253 Tetracycline biosynthesis     CP966_29080  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:sgal01004]     CP966_29080    01008 Polyketide biosynthesis proteins [BR:sgal01008]     CP966_29080 Lipid biosynthesis proteins [BR:sgal01004]  Polyketide synthase   Component type    CP966_29080 Polyketide biosynthesis proteins [BR:sgal01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      CP966_29080     Nonaketide PKS      CP966_29080     Decaketide PKS      CP966_29080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEU68873 UniProt:  Q8VWB1 LinkDB All DBs Position 6356390..6356665 Genome browser AA seq 91 aa AA seqDB search MSAFTVEELFQIMRECAGEEEAVDLADAAEQEFALLGYDSLALMEAISRVERGLGIALPE ETVGEVLTPAAFVDVVNAELARSAPVVEAAG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgtccgctttcacggtagaagagcttttccagatcatgcgcgagtgcgcgggcgaggag gaggccgtcgatctggccgacgccgcggagcaggagttcgccctgctcggctacgactcc ctcgcgctcatggaggcgatcagcagggtggagcggggcctcggcatcgccctgcccgag gagacggtgggcgaggtgctgacgcccgccgcgttcgtcgacgtcgtcaacgccgaactg gcccgcagcgcgcccgtggtggaggccgccggatga

DBGET integrated database retrieval system