Streptomyces globisporus: WQO_09935 Help Entry WQO_09935         CDS       T04209                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sgb  Streptomyces globisporus Pathway sgb00998   Biosynthesis of various antibiotics sgb01100   Metabolic pathways sgb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WQO_09935    00074 Mycolic acid biosynthesis     WQO_09935   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WQO_09935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF3219 Motif Other DBs NCBI-ProteinID:  ALU93648 UniProt:  A0A0U2SUC8 LinkDB All DBs Position 2306242..2306490 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVKGLAEIVNEIAGIPEEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDAADYILKHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacgcaggaagagatcgtcaagggtctcgccgagatcgtcaacgagatcgcc gggatcccggaggaggacgtccagctggacaagtccttcaccgacgacctcgacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtgaagatcccc gacgaggacgtcaagaacctcaagacggtcggcgacgccgccgactacatcctgaagcac cagggctga

DBGET integrated database retrieval system