Streptomyces globisporus: WQO_28560 Help Entry WQO_28560         CDS       T04209                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sgb  Streptomyces globisporus Pathway sgb00998   Biosynthesis of various antibiotics sgb01100   Metabolic pathways sgb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WQO_28560    00074 Mycolic acid biosynthesis     WQO_28560   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WQO_28560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ALU96938 UniProt:  A0A0U3M9P8 LinkDB All DBs Position 6477482..6477715 Genome browser AA seq 77 aa AA seqDB search MSTSEEISTLLVTKFGTDPEAIRPDVPLHRLRLDSLALEELRLHIEDRLDVDLEDVALTS RDTVGRLVEAVQGKVTA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcacgtcggaagagatcagcacgctgctggtgacgaagttcggaaccgaccccgag gccatccgccccgatgttccgctgcaccggctgcggctggactccctcgccctggaggag ctgcggctgcacatcgaggaccggctggacgtggacctggaggacgtcgcgctcacctcg cgcgacaccgtcggccgcctcgtcgaggccgtgcaggggaaggtcacggcatga

DBGET integrated database retrieval system