Streptomyces griseoviridis: ELQ87_00910 Help Entry ELQ87_00910       CDS       T06660                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sgd  Streptomyces griseoviridis Pathway sgd00998   Biosynthesis of various antibiotics sgd01100   Metabolic pathways sgd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ELQ87_00910    00074 Mycolic acid biosynthesis     ELQ87_00910   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ELQ87_00910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AZS83012 UniProt:  A0A3Q9KPQ3 LinkDB All DBs Position 199161..199418 Genome browser AA seq 85 aa AA seqDB search MSAIDEATRKHVKNIVCDILEVEPEEVTETSLLAEEHDADSLRSIEILAAIEVALQVSIA QAEMKRMVNLEGIYAVLADARTRVK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgtccgccatcgacgaagcgacccgcaagcacgtgaagaacatcgtctgcgacatcctg gaggtggagcccgaggaggtcaccgagaccagcctgctcgccgaggagcacgacgccgac tcgctgcgctccatcgagatcctggccgccatcgaggtcgccctccaggtctccatcgcg caggccgagatgaagcgcatggtcaacctcgaaggcatctacgcggtgctggccgacgcg cggacgagggtcaagtag

DBGET integrated database retrieval system