Stenotrophomonas geniculata: RKE57_08605
Help
Entry
RKE57_08605 CDS
T09411
Name
(GenBank) ABC transporter transmembrane domain-containing protein
KO
K06147
ATP-binding cassette, subfamily B, bacterial
Organism
sgen
Stenotrophomonas geniculata
Brite
KEGG Orthology (KO) [BR:
sgen00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
sgen02000
]
RKE57_08605
Transporters [BR:
sgen02000
]
ABC transporters, eukaryotic type
ABCB (MDR/TAP) subfamily
ABCB-BAC subgroup
RKE57_08605
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_membrane
ABC_tran
SMC_N
AAA_22
AAA_16
AAA_21
ABC_ATPase
AAA_29
AAA_25
RsgA_GTPase
AAA_33
Zeta_toxin
MMR_HSR1
Rad17
DUF3851
Motif
Other DBs
NCBI-ProteinID:
WNF12178
LinkDB
All DBs
Position
complement(1838880..1840652)
Genome browser
AA seq
590 aa
AA seq
DB search
MTDKDDAPASTPPLRRLGSLRTLWPFVRRHSGLFTAWLLALAVSSAATLSLPPAVKQMID
HGFSSGGQINRAFALLMLVAVVMALGTAARFYFVSLLGEKVVADLRSQLYAHLIQLGAGF
HDRSRSGELVSRLTADTELLRSVVGSTMSVALRSTVTVIGSLAMLFVTSPRLAAWSLLGI
PLAVLPIIIGARKLRTVARNSQDRIADANSLASETLGAVRTVQAHAREPYERGRFDKALG
DAIGAARRRIGAQSLVTASAILLVFGAIVGVLWLGAHDVIDGRLSAGTLGQFVLYALIGG
GSVGALAEVWNELQRAAGGMGRIGELLQEDIEIRAPAQPHALPQPLRGEIRFDDVVFHYP
QRPEQAALDHFNLHVRPGETVALVGPSGAGKSTVLSMLLRFHDPASGRIDVDGIDVRQVD
PAELRAQLALVPQQPTLFAASARDNIRYGRLQASDAEVEDAARAAEADGFLRALPQGYDS
ELGERGARLSGGQQQRVAIARALLKDAPILLLDEATSALDAQSEHSVQQALERLMAGRTT
LVIAHRLATVLKADRIVVMDQGRIVAEGTHAQLLAEDGLYAELARLQFID
NT seq
1773 nt
NT seq
+upstream
nt +downstream
nt
atgactgacaaggacgacgcccccgcttcgaccccgccgctgcggcgcctcggcagcctg
cgcacgctgtggccattcgtgcgccgccatagcgggctgttcaccgcctggctgctggcc
ctggcggtgtcttcggccgccacgctgagcctgccgccggcggtgaagcagatgatcgat
catggtttcagcagtggcggccagatcaaccgcgccttcgccctgctgatgctggtggcg
gtcgtgatggcgttgggcacggccgcgcgtttctacttcgtgtcgctgctcggcgaaaaa
gtcgtggccgacctgcgcagccagctgtatgcccacctgatccagctgggcgccggcttc
cacgaccgcagccgcagcggcgaactggtctcgcgcctgaccgcggacaccgaactgctg
cgcagcgtggtcggctcgaccatgtccgtagcattgcgcagcacggtcactgtcatcggc
agcctggcgatgctgttcgtcaccagcccgcggctggccgcatggtcgctgctcggcatt
ccactggcggtgctgccgatcatcatcggtgcgcgcaagctgcgcacggtcgcgcgcaac
agccaggaccgcatcgccgatgccaacagcctggccagcgagacgctgggcgcggtgcgc
acggtgcaggcacatgcacgcgaaccatacgaacgcggtcgcttcgacaaggcgctcggt
gacgccatcggcgccgcccgccgccgcatcggtgcacagtcgctggtcaccgccagcgcc
atcctgctggtgttcggcgccatcgtcggtgtgctgtggctgggcgcgcacgacgtcatc
gacggccgcctcagcgccggcacgctgggtcagttcgtgctgtatgcattgatcggcggc
ggttcggtgggcgcgctggccgaagtatggaacgagctgcagcgcgcggccggcggcatg
ggccgcatcggcgaactgttgcaggaagacatcgagatccgcgcaccggcccagccgcat
gcactgccgcaaccgctgcgtggcgagatccggttcgacgacgtggtgttccactacccg
cagcgaccggagcaggccgcactggaccacttcaacctgcatgtgcgccccggcgagacc
gtagcgctggtgggtccgtcaggggcgggcaagagcacggtgctttcgatgctgctgcgc
ttccatgacccggccagcggccgcatcgacgtggacggcatcgacgtgcgccaggtcgac
ccggccgagctgcgtgcgcagctggcgctggtgccacagcagcctacgctgttcgctgcc
agtgcccgcgacaacatccgctatggccgcctgcaggccagcgacgccgaggtcgaggat
gccgcacgagcggccgaggccgacggtttcctgcgcgcgttgccgcagggctatgacagc
gagctgggtgagcgcggtgcccgcctgtccggtggccagcagcagcgtgtggcgattgcc
cgtgcgctgctgaaggatgcgccgatcctgctgctggatgaagccaccagcgcgctggat
gcacagagcgaacacagcgtgcagcaggcattggaacggttgatggcgggtcgcaccacg
ctggtcatcgcccaccgcctggccaccgtgctcaaggccgaccgcatcgtggtgatggac
cagggccgcatcgtcgccgagggcacgcacgcacagctgctggccgaagacggactgtac
gctgaactggcacgcctgcagttcatcgattga
DBGET
integrated database retrieval system