Stenotrophomonas geniculata: RKE57_17105 Help Entry RKE57_17105       CDS       T09411                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism sgen  Stenotrophomonas geniculata Brite KEGG Orthology (KO) [BR:sgen00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sgen03036]     RKE57_17105 Chromosome and associated proteins [BR:sgen03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     RKE57_17105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Taxilin Mod_r Stathmin YabA bZIP_1 FAZ1_C DUF3450 NRBF2 UPF0449 bZIP_2 GIT_CC Motif Other DBs NCBI-ProteinID:  WNF09763 LinkDB All DBs Position 3721107..3721328 Genome browser AA seq 73 aa AA seqDB search MEPADPLAQLQDFAARVEALLERNQRLAEENRSLRHQQEQLVAERSTLLAKNEQARSRVE AMISRLKSLEQHT NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggaacccgccgacccccttgcccagctgcaggacttcgccgcccgcgtggaagcgttg cttgaacgcaaccagcgcctggccgaggagaaccgcagcctgcgccaccagcaggaacag cttgtggccgagcgctcgacgctgctggccaagaatgagcaggcacgttcgcgggtggaa gcaatgatcagccggctcaaatccctggagcagcacacatga

DBGET integrated database retrieval system