Streptomyces griseofuscus: HEP81_00498 Help Entry HEP81_00498       CDS       T07010                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sgf  Streptomyces griseofuscus Pathway sgf00261   Monobactam biosynthesis sgf01100   Metabolic pathways sgf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HEP81_00498  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgf01008]     HEP81_00498 Polyketide biosynthesis proteins [BR:sgf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HEP81_00498 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QNT90834 UniProt:  A0A1X4H040 LinkDB All DBs Position 562157..562327 Genome browser AA seq 56 aa AA seqDB search MTNPFDDTDRSYVVLRNSLAEYSLWPVGITVPDGWEVVHEEDSRQACLSYIEEQAA NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccccttcgacgacacggaccgttcttacgtcgtcctgcgcaactccctcgcc gagtactccctttggcccgtcggcatcaccgtgcccgacggctgggaggtcgtccatgag gaggactcccggcaggcgtgcctgtcctacatcgaggagcaggcggcgtga

DBGET integrated database retrieval system