Streptomyces griseofuscus: HEP81_01869 Help Entry HEP81_01869       CDS       T07010                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism sgf  Streptomyces griseofuscus Pathway sgf00362   Benzoate degradation sgf00621   Dioxin degradation sgf00622   Xylene degradation sgf01100   Metabolic pathways sgf01120   Microbial metabolism in diverse environments sgf01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:sgf00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     HEP81_01869    00622 Xylene degradation     HEP81_01869    00621 Dioxin degradation     HEP81_01869 Enzymes [BR:sgf01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      HEP81_01869 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 DUF2917 Motif Other DBs NCBI-ProteinID:  QNT92197 UniProt:  A0A1X4GWP3 LinkDB All DBs Position complement(2105986..2106183) Genome browser AA seq 65 aa AA seqDB search MPLIHVQQTPGKTAEQKAELVRELTDAYVKATGSKPESVWVTVQEIGTDSWSIAGETLAA RAAKR NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgcctctcatccatgtgcagcagacccccggcaagaccgccgagcagaaggccgagctg gtccgcgagctgaccgacgcctacgtcaaggccaccggcagcaagccggagagcgtctgg gtgaccgtgcaggagatcggcaccgacagctggtccatcgccggcgagacgctggccgcc cgcgccgccaagcgctga

DBGET integrated database retrieval system