Streptomyces griseofuscus: HEP81_02295 Help Entry HEP81_02295       CDS       T07010                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sgf  Streptomyces griseofuscus Pathway sgf00998   Biosynthesis of various antibiotics sgf01100   Metabolic pathways sgf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HEP81_02295    00074 Mycolic acid biosynthesis     HEP81_02295   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HEP81_02295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QNT92621 UniProt:  A0A7H1PX41 LinkDB All DBs Position 2607290..2607562 Genome browser AA seq 90 aa AA seqDB search MNHVYDRLVNLLHKKFEVPADRLGPTATLGELDLDSLAVVELYVTLQEEWGVALDDSAAS AELTVAEVARSVSEQLEPPTGPVPHDGSGR NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaccatgtctacgaccgtctcgtgaacctgctgcacaagaagttcgaggtccccgcc gaccgcctcgggcccaccgccaccctcggcgaactcgacctggactcccttgccgtggtg gagctctacgtcaccctccaggaggagtggggtgtcgccctggacgactcggcggcatcc gcggagctgaccgtcgccgaggtggcccgctcggtgagcgagcaactggagccgcccacc gggccggtgccgcacgacggaagcggacggtga

DBGET integrated database retrieval system