Streptomyces griseofuscus: HEP81_02679 Help Entry HEP81_02679       CDS       T07010                                  Name (GenBank) ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism sgf  Streptomyces griseofuscus Pathway sgf00190   Oxidative phosphorylation sgf01100   Metabolic pathways Module sgf_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sgf00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     HEP81_02679  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sgf00194]     HEP81_02679 Photosynthesis proteins [BR:sgf00194]  Photosystem and electron transport system   F-type ATPase [OT]    HEP81_02679 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QNT92996 UniProt:  A0A3R8RAG7 LinkDB All DBs Position complement(3045341..3045568) Genome browser AA seq 75 aa AA seqDB search MSQTLAAVTGSLSSVGYGLSAIGPGVGVGIIFGNGTQALARQPEAAGLIRSNQILGFAFC EALALIGLVMPFVYS NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtcccagacccttgccgctgtcactggttcgctcagctccgtcggttacggcctttcg gccatcggccccggcgtcggcgtcggcatcatcttcggtaacggcacgcaggctcttgcg cgtcagcccgaggcggcgggcctgatccgctccaaccagatcctcggcttcgcgttctgt gaggcgctggccctcatcggcctcgtcatgccgttcgtctactcctga

DBGET integrated database retrieval system