Streptomyces griseofuscus: HEP81_02835 Help Entry HEP81_02835       CDS       T07010                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism sgf  Streptomyces griseofuscus Brite KEGG Orthology (KO) [BR:sgf00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     HEP81_02835 Enzymes [BR:sgf01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      HEP81_02835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 Glrx-like Thioredoxin GST_N_3 IU_nuc_hydro Ank_KRIT1 Motif Other DBs NCBI-ProteinID:  QNT93149 UniProt:  A0A1X4GU96 LinkDB All DBs Position 3207487..3207729 Genome browser AA seq 80 aa AA seqDB search MQGTVTMYSTTWCGYCRRLKSQMEREGIAYTEINIEQDPESAAFVEKANGGNQTVPTVLF ADGTTMTNPSLAQVKQKLAA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcagggcactgtgacgatgtacagcacgacttggtgcggctactgccgtcggctgaag agccagatggagcgggagggcatcgcctacaccgagatcaacatcgagcaggaccccgag tccgcggccttcgtggagaaggcgaatggcggaaaccagacggtcccgaccgtgctcttc gcggacggcaccacgatgacgaacccttcgctggcccaggtcaagcagaagctcgcggcc tga

DBGET integrated database retrieval system