Streptomyces griseofuscus: HEP81_05358 Help Entry HEP81_05358       CDS       T07010                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sgf  Streptomyces griseofuscus Pathway sgf00998   Biosynthesis of various antibiotics sgf01100   Metabolic pathways sgf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HEP81_05358    00074 Mycolic acid biosynthesis     HEP81_05358   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HEP81_05358 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QNT95611 UniProt:  A0A1X4GN76 LinkDB All DBs Position complement(5874841..5875089) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVEGLAEIVNEIAGIPVEDVQVDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDATDYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacccaggaagagatcgtcgaaggtctcgccgaaatcgtcaacgagatcgcc ggcatcccggttgaggacgtccaggtggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtgaagatcccg gacgaggacgtcaagaacctcaagaccgtcggcgacgcgaccgactacatcctcaagcac caggcctga

DBGET integrated database retrieval system